Property Summary

NCBI Gene PubMed Count 6
PubMed Score 9.90
PubTator Score 5.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer -1.400 5.5e-04
ependymoma 1.100 3.5e-04
glioblastoma 1.900 3.7e-03
interstitial cystitis 1.200 1.7e-02
invasive ductal carcinoma 1.200 1.1e-02
lung cancer -1.100 2.4e-03
lung carcinoma 1.200 4.3e-12
malignant mesothelioma 4.600 2.1e-09
ovarian cancer -1.800 1.1e-05
pituitary cancer -1.200 1.5e-02
psoriasis 2.200 3.1e-05
tuberculosis 1.400 1.0e-04

AA Sequence

MRQLKGKPKKETSKDKKERKQAMQEARQQITTVVLPTLAVVVLLIVVFVYVATRPTITE                 1 - 59
//

Text Mined References (7)

PMID Year Title