Property Summary

NCBI Gene PubMed Count 6
PubMed Score 7.75
PubTator Score 5.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 4.600 0.000
psoriasis 2.200 0.000
posterior fossa group B ependymoma 1.600 0.000
glioblastoma 1.900 0.004
tuberculosis 1.400 0.000
lung cancer -1.100 0.002
interstitial cystitis 1.200 0.017
lung carcinoma 1.200 0.000
Breast cancer -1.400 0.001
invasive ductal carcinoma 1.200 0.011
ovarian cancer 3.200 0.000
pituitary cancer -1.200 0.015

AA Sequence

MRQLKGKPKKETSKDKKERKQAMQEARQQITTVVLPTLAVVVLLIVVFVYVATRPTITE                 1 - 59
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21516116 2011 Next-generation sequencing to generate interactome datasets.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10863097 2000 Characterization of the Fugu rubripes NLK and FN5 genes flanking the NF1 (Neurofibromatosis type 1) gene in the 5' direction and mapping of the human counterparts.