Property Summary

NCBI Gene PubMed Count 16
PubMed Score 4.51
PubTator Score 110.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Small cell carcinoma of lung 45
Disease Target Count P-value
breast carcinoma 1614 5.20717276674536E-31
non-small cell lung cancer 2798 1.00218315261662E-16
lung adenocarcinoma 2714 8.56808873154298E-15
Breast cancer 3099 4.68788145411823E-11
ovarian cancer 8492 8.34750856139245E-10
juvenile dermatomyositis 1189 2.98881396857981E-9
posterior fossa group A ependymoma 1511 1.85111310961674E-8
lung cancer 4473 2.24395080903525E-6
Duchenne muscular dystrophy 602 6.49765537694447E-6
ulcerative colitis 2087 6.66536804749011E-6
medulloblastoma, large-cell 6234 9.81811036959217E-5
cystic fibrosis 1670 1.16465393997079E-4
invasive ductal carcinoma 2950 1.79432763625765E-4
colon cancer 1475 1.96714216075685E-4
ductal carcinoma in situ 1745 4.79043357867082E-4
group 3 medulloblastoma 2254 9.16486989036124E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00105291988840455
pituitary cancer 1972 0.00131346870275699
Down syndrome 548 0.00835120560274125
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0116308613509046
Pick disease 1893 0.0147976670075755
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0185787068014131
atypical teratoid / rhabdoid tumor 4369 0.0205901451774613
primitive neuroectodermal tumor 3031 0.0444803282032628

Expression

Synonym

Gene

PANTHER Protein Class (1)

PDB

3Q5U  

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
C. elegans OMA Inparanoid

Pathway (1)

Gene RIF (5)

PMID Text
23089641 biochemical and functional characterization of human phospholipid scramblase 4
21690087 Crystallographic analysis of mammalian importin alpha1 in complex with the hPLSCR4-NLS reveals this minimal NLS binds specifically and exclusively to the minor binding site of importin alpha
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19540310 Results show that binding affinities of the peptides are in the order hPLSCR1>hPLSCR3>hPLSCR2>hPLSCR4 for Ca2+ and in the order hPLSCR1>hPLSCR2>hPLSCR3>hPLSCR4 for Mg2+.
19333378 SLPI is a ligand for PLSCR1 and PLSCR4, which also interact directly with the CD4 receptor at the cell surface of T lymphocytes

AA Sequence

MSGVVPTAPEQPAGEMENQTKPPDPRPDAPPEYNSHFLPGPPGTAVPPPTGYPGGLPMGYYSPQQPSTFP      1 - 70
LYQPVGGIHPVRYQPGKYPMPNQSVPITWMPGPTPMANCPPGLEYLVQLDNIHVLQHFEPLEMMTCFETN     71 - 140
NRYDIKNNSDQMVYIVTEDTDDFTRNAYRTLRPFVLRVTDCMGREIMTMQRPFRCTCCCFCCPSARQELE    141 - 210
VQCPPGVTIGFVAEHWNLCRAVYSIQNEKKENVMRVRGPCSTYGCGSDSVFEVKSLDGISNIGSIIRKWN    211 - 280
GLLSAMADADHFDIHFPLDLDVKMKAMIFGACFLIDFMYFERSPPQRSR                         281 - 329
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23089641 2012 Biochemical and functional characterization of human phospholipid scramblase 4 (hPLSCR4).
23088713 2012 Protein interactions of the transcription factor Hoxa1.
21690087 2011 A minimal nuclear localization signal (NLS) in human phospholipid scramblase 4 that binds only the minor NLS-binding site of importin alpha1.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19540310 2009 Calcium binding studies of peptides of human phospholipid scramblases 1 to 4 suggest that scramblases are new class of calcium binding proteins in the cell.
19333378 2009 The phospholipid scramblases 1 and 4 are cellular receptors for the secretory leukocyte protease inhibitor and interact with CD4 at the plasma membrane.
18256029 2008 Identification of Alix-type and Non-Alix-type ALG-2-binding sites in human phospholipid scramblase 3: differential binding to an alternatively spliced isoform and amino acid-substituted mutants.
More...