Property Summary

NCBI Gene PubMed Count 16
PubMed Score 4.51
PubTator Score 110.20

Knowledge Summary

Patent

No data available

Expression

Synonym

Gene

PANTHER Protein Class (1)

PDB

3Q5U  

Gene RIF (5)

PMID Text
23089641 biochemical and functional characterization of human phospholipid scramblase 4
21690087 Crystallographic analysis of mammalian importin alpha1 in complex with the hPLSCR4-NLS reveals this minimal NLS binds specifically and exclusively to the minor binding site of importin alpha
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19540310 Results show that binding affinities of the peptides are in the order hPLSCR1>hPLSCR3>hPLSCR2>hPLSCR4 for Ca2+ and in the order hPLSCR1>hPLSCR2>hPLSCR3>hPLSCR4 for Mg2+.
19333378 SLPI is a ligand for PLSCR1 and PLSCR4, which also interact directly with the CD4 receptor at the cell surface of T lymphocytes

AA Sequence

MSGVVPTAPEQPAGEMENQTKPPDPRPDAPPEYNSHFLPGPPGTAVPPPTGYPGGLPMGYYSPQQPSTFP      1 - 70
LYQPVGGIHPVRYQPGKYPMPNQSVPITWMPGPTPMANCPPGLEYLVQLDNIHVLQHFEPLEMMTCFETN     71 - 140
NRYDIKNNSDQMVYIVTEDTDDFTRNAYRTLRPFVLRVTDCMGREIMTMQRPFRCTCCCFCCPSARQELE    141 - 210
VQCPPGVTIGFVAEHWNLCRAVYSIQNEKKENVMRVRGPCSTYGCGSDSVFEVKSLDGISNIGSIIRKWN    211 - 280
GLLSAMADADHFDIHFPLDLDVKMKAMIFGACFLIDFMYFERSPPQRSR                         281 - 329
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23089641 2012 Biochemical and functional characterization of human phospholipid scramblase 4 (hPLSCR4).
23088713 2012 Protein interactions of the transcription factor Hoxa1.
21690087 2011 A minimal nuclear localization signal (NLS) in human phospholipid scramblase 4 that binds only the minor NLS-binding site of importin alpha1.
21516116 2011 Next-generation sequencing to generate interactome datasets.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19540310 2009 Calcium binding studies of peptides of human phospholipid scramblases 1 to 4 suggest that scramblases are new class of calcium binding proteins in the cell.
19333378 2009 The phospholipid scramblases 1 and 4 are cellular receptors for the secretory leukocyte protease inhibitor and interact with CD4 at the plasma membrane.
18256029 2008 Identification of Alix-type and Non-Alix-type ALG-2-binding sites in human phospholipid scramblase 3: differential binding to an alternatively spliced isoform and amino acid-substituted mutants.
More...