Property Summary

NCBI Gene PubMed Count 18
PubMed Score 4.51
PubTator Score 110.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 2.1e-02
autosomal dominant Emery-Dreifuss muscul... 1.306 1.2e-02
Breast cancer -2.300 4.7e-11
breast carcinoma -1.300 2.4e-04
colon cancer -1.500 2.0e-04
cystic fibrosis 1.500 1.2e-04
Down syndrome 1.700 8.4e-03
Duchenne muscular dystrophy 1.600 6.5e-06
ductal carcinoma in situ -1.600 4.8e-04
ependymoma 1.400 3.2e-02
group 3 medulloblastoma -2.300 9.2e-04
intraductal papillary-mucinous adenoma (... -1.700 1.1e-03
intraductal papillary-mucinous carcinoma... -1.200 1.9e-02
invasive ductal carcinoma -2.900 1.8e-04
juvenile dermatomyositis 1.385 3.0e-09
lung adenocarcinoma -1.400 8.6e-15
lung cancer -1.700 3.4e-05
medulloblastoma, large-cell -3.000 9.8e-05
non-small cell lung cancer -1.607 1.0e-16
ovarian cancer -4.200 8.3e-10
Pick disease 1.100 1.5e-02
pituitary cancer -2.100 1.3e-03
primitive neuroectodermal tumor -1.200 4.4e-02
ulcerative colitis -1.100 6.7e-06

Gene RIF (6)

AA Sequence

MSGVVPTAPEQPAGEMENQTKPPDPRPDAPPEYNSHFLPGPPGTAVPPPTGYPGGLPMGYYSPQQPSTFP      1 - 70
LYQPVGGIHPVRYQPGKYPMPNQSVPITWMPGPTPMANCPPGLEYLVQLDNIHVLQHFEPLEMMTCFETN     71 - 140
NRYDIKNNSDQMVYIVTEDTDDFTRNAYRTLRPFVLRVTDCMGREIMTMQRPFRCTCCCFCCPSARQELE    141 - 210
VQCPPGVTIGFVAEHWNLCRAVYSIQNEKKENVMRVRGPCSTYGCGSDSVFEVKSLDGISNIGSIIRKWN    211 - 280
GLLSAMADADHFDIHFPLDLDVKMKAMIFGACFLIDFMYFERSPPQRSR                         281 - 329
//

Text Mined References (21)

PMID Year Title