Property Summary

NCBI Gene PubMed Count 12
Grant Count 9
R01 Count 3
Funding $3,254,180.25
PubMed Score 21.67
PubTator Score 14.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
posterior fossa group B ependymoma 1.400 0.000
glioblastoma 1.300 0.000
group 4 medulloblastoma 1.500 0.000
medulloblastoma, large-cell 1.200 0.004
lung cancer 2.000 0.000
Breast cancer 2.500 0.028
adult high grade glioma 1.400 0.001
atypical teratoid/rhabdoid tumor 1.100 0.000

Gene RIF (6)

PMID Text
25821040 Single nucleotide polymorphism in ACN9 gene is associated with alcohol dependence.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18163977 ACN9 is involved in the predisposition to alcohol dependence.
18163977 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPGRHVSRVRALYKRVLQLHRVLPPDLKSLGDQYVKDEFRRHKTVGSDEAQRFLQEWEVYATALLQQANE      1 - 70
NRQNSTGKACFGTFLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSISESMKPKF                    71 - 125
//

Text Mined References (13)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25821040 2015 ACN9 and alcohol dependence: family-based association analysis in multiplex alcohol dependence families.
24954417 2014 The LYR factors SDHAF1 and SDHAF3 mediate maturation of the iron-sulfur subunit of succinate dehydrogenase.
23719583 2013 Genome-wide association study identifies a region on chromosome 11q14.3 associated with late rectal bleeding following radiation therapy for prostate cancer.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18163977 2008 A Systematic single nucleotide polymorphism screen to fine-map alcohol dependence genes on chromosome 7 identifies association with a novel susceptibility gene ACN9.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
More...