Property Summary

NCBI Gene PubMed Count 6
Grant Count 6
R01 Count 1
Funding $956,265.33
PubMed Score 84.99
PubTator Score 51.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.017 0.017
Multiple myeloma 1.089 0.030
astrocytic glioma -1.400 0.030
ependymoma -1.800 0.040
medulloblastoma, large-cell -1.700 0.000
invasive ductal carcinoma 1.100 0.005
ovarian cancer 2.200 0.000
Breast cancer 1.600 0.000

Gene RIF (3)

PMID Text
21424380 Single nucleotide polymorphisms in C16orf61 gene is associated with breast cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19844255 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKL      1 - 70
FNPPEESEK                                                                  71 - 79
//

Text Mined References (9)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21424380 2011 Potential novel candidate polymorphisms identified in genome-wide association study for breast cancer susceptibility.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20220131 2010 The conserved mitochondrial twin Cx9C protein Cmc2 Is a Cmc1 homologue essential for cytochrome c oxidase biogenesis.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.