Property Summary

NCBI Gene PubMed Count 6
PubMed Score 93.49
PubTator Score 51.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma -1.400 3.0e-02
Breast cancer 1.600 9.2e-08
ependymoma -1.800 4.0e-02
invasive ductal carcinoma 1.100 5.1e-03
medulloblastoma, large-cell -1.700 5.3e-05
Multiple myeloma 1.089 3.0e-02
ovarian cancer 2.200 1.4e-05
Waldenstrons macroglobulinemia 1.017 1.7e-02

Synonym

Accession Q9NRP2 D3DUK6
Symbols DC13
C16orf61
2310061C15Rik

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKL      1 - 70
FNPPEESEK                                                                  71 - 79
//

Text Mined References (9)

PMID Year Title