Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.68
PubTator Score 3.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
acute myeloid leukemia -1.200 2.6e-03
atypical teratoid / rhabdoid tumor 1.400 2.6e-06
ependymoma 1.200 3.3e-13
glioblastoma 1.200 3.2e-07
group 3 medulloblastoma 1.100 9.7e-04
medulloblastoma, large-cell 1.400 1.7e-05
osteosarcoma 1.858 8.9e-05
ovarian cancer -2.000 5.1e-06
pancreatic ductal adenocarcinoma liver m... -2.414 1.8e-02
pediatric high grade glioma 1.300 9.3e-07

Gene RIF (3)

AA Sequence

METLYRVPFLVLECPNLKLKKPPWLHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQR      1 - 70
PVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMR     71 - 140
MKLPGYLMG                                                                 141 - 149
//

Text Mined References (15)

PMID Year Title