Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.25
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.0e-09
psoriasis 6694 7.3e-06
Multiple myeloma 1332 9.5e-05
lung cancer 4740 1.8e-03
hereditary spastic paraplegia 318 1.1e-02
Waldenstrons macroglobulinemia 765 1.6e-02
Disease Target Count Z-score Confidence
Temporal lobe epilepsy 7 3.043 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
hereditary spastic paraplegia -1.087 1.1e-02
lung cancer 1.600 1.8e-03
Multiple myeloma 1.835 9.5e-05
osteosarcoma -3.393 1.0e-09
psoriasis -2.700 7.3e-06
Waldenstrons macroglobulinemia 1.143 1.6e-02

AA Sequence

MKKVRLKELESRLQQVDGFEKPKLLLEQYPTRPHIAACMLYTIHNTYDDIENKVVADLGCGCGVLSIGTA      1 - 70
MLGAGLCVGFDIDEDALEIFNRNAEEFELTNIDMVQCDVCLLSNRMSKSFDTVIMNPPFGTKNNKGTDMA     71 - 140
FLKTALEMARTAVYSLHKSSTREHVQKKAAEWKIKIDIIAELRYDLPASYKFHKKKSVDIEVDLIRFSF     141 - 209
//

Text Mined References (6)

PMID Year Title