Property Summary

NCBI Gene PubMed Count 13
Grant Count 60
R01 Count 31
Funding $7,740,605.76
PubMed Score 193.93
PubTator Score 96.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.051 0.027
Multiple myeloma 1.654 0.002
psoriasis 1.700 0.000
osteosarcoma 1.633 0.000
lung cancer 2.400 0.001
Parkinson's disease -1.400 0.019
ovarian cancer 1.500 0.001
pituitary cancer 1.100 0.000

Synonym

Accession Q9NRN7 B2R6D1 B4DDW7 Q9C068 Q9P0Q3 Q9UG80 Q9Y389
Symbols ACPS
LYS2
LYS5
CGI-80
AASD-PPT

Gene

PANTHER Protein Class (1)

PDB

2CG5   2BYD   2C43  

Gene RIF (2)

PMID Text
19933275 Our study identifies human PPT as the FDH-modifying enzyme and supports the hypothesis that mammals utilize a single enzyme for all phosphopantetheinylation reactions.
12815048 humans appear to utilize a single, broad specificity enzyme, 4'-phosphopantetheine transferase, for all posttranslational 4'-phosphopantetheinylation reactions

AA Sequence

MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKL      1 - 70
VAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGS     71 - 140
IPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIG    141 - 210
QVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSS    211 - 280
AVPMTPEDPSFWDCFCFTEEIPIRNGTKS                                             281 - 309
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19933275 2010 Acyl carrier protein-specific 4'-phosphopantetheinyl transferase activates 10-formyltetrahydrofolate dehydrogenase.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18022563 2007 Mechanism and substrate recognition of human holo ACP synthase.
More...