Property Summary

NCBI Gene PubMed Count 13
PubMed Score 204.92
PubTator Score 96.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
lung cancer 2.400 5.7e-04
Multiple myeloma 1.654 2.0e-03
osteosarcoma 1.633 1.0e-04
ovarian cancer -1.400 3.5e-04
Parkinson's disease -1.400 1.9e-02
pituitary cancer 1.100 8.6e-05
psoriasis 1.700 1.4e-04
Waldenstrons macroglobulinemia 1.051 2.7e-02

Gene RIF (2)

AA Sequence

MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKL      1 - 70
VAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGS     71 - 140
IPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIG    141 - 210
QVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSS    211 - 280
AVPMTPEDPSFWDCFCFTEEIPIRNGTKS                                             281 - 309
//

Text Mined References (22)

PMID Year Title