Property Summary

NCBI Gene PubMed Count 18
PubMed Score 4.92
PubTator Score 5.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
psoriasis 6694 4.5e-55
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 1.1

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.300 4.5e-55

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (2)

AA Sequence

MGPSTPLLILFLLSWSGPLQGQQHHLVEYMERRLAALEERLAQCQDQSSRHAAELRDFKNKMLPLLEVAE      1 - 70
KEREALRTEADTISGRVDRLEREVDYLETQNPALPCVEFDEKVTGGPGTKGKGRRNEKYDMVTDCGYTIS     71 - 140
QVRSMKILKRFGGPAGLWTKDPLGQTEKIYVLDGTQNDTAFVFPRLRDFTLAMAARKASRVRVPFPWVGT    141 - 210
GQLVYGGFLYFARRPPGRPGGGGEMENTLQLIKFHLANRTVVDSSVFPAEGLIPPYGLTADTYIDLAADE    211 - 280
EGLWAVYATREDDRHLCLAKLDPQTLDTEQQWDTPCPRENAEAAFVICGTLYVVYNTRPASRARIQCSFD    281 - 350
ASGTLTPERAALPYFPRRYGAHASLRYNPRERQLYAWDDGYQIVYKLEMRKKEEEV                  351 - 406
//

Text Mined References (18)

PMID Year Title