Property Summary

Ligand Count 2
NCBI Gene PubMed Count 83
PubMed Score 319.00
PubTator Score 73.18

Knowledge Summary

Patent (3,138)

Expression

  Differential Expression (22)

Disease log2 FC p
active ulcerative colitis 1.513 2.0e-02
acute myeloid leukemia 1.100 6.6e-03
acute quadriplegic myopathy 1.521 9.3e-06
adrenocortical carcinoma -1.036 1.1e-02
atypical teratoid / rhabdoid tumor 2.700 8.9e-07
breast carcinoma -1.200 2.0e-04
ductal carcinoma in situ -1.100 3.3e-03
gastric carcinoma 1.100 1.0e-02
glioblastoma 1.400 5.9e-04
invasive ductal carcinoma -1.700 2.6e-04
juvenile dermatomyositis 1.296 7.2e-11
lung adenocarcinoma -1.100 1.9e-09
lung carcinoma -1.200 1.5e-24
non-small cell lung cancer -1.267 5.6e-18
ovarian cancer -2.600 4.6e-12
pancreatic cancer 1.500 1.1e-02
pancreatic ductal adenocarcinoma liver m... 1.189 3.6e-02
Pick disease 2.300 1.5e-04
pituitary cancer -1.700 3.5e-05
primitive neuroectodermal tumor 1.600 1.0e-05
Rheumatoid arthritis 1.600 1.4e-03
spina bifida -2.045 2.3e-02

Protein-protein Interaction (4)

Gene RIF (68)

AA Sequence

MRPKTFPATTYSGNSRQRLQEIREGLKQPSKSSVQGLPAGPNSDTSLDAKVLGSKDATRQQQQMRATPKF      1 - 70
GPYQKALREIRYSLLPFANESGTSAAAEVNRQMLQELVNAGCDQEMAGRALKQTGSRSIEAALEYISKMG     71 - 140
YLDPRNEQIVRVIKQTSPGKGLMPTPVTRRPSFEGTGDSFASYHQLSGTPYEGPSFGADGPTALEEMPRP    141 - 210
YVDYLFPGVGPHGPGHQHQHPPKGYGASVEAAGAHFPLQGAHYGRPHLLVPGEPLGYGVQRSPSFQSKTP    211 - 280
PETGGYASLPTKGQGGPPGAGLAFPPPAAGLYVPHPHHKQAGPAAHQLHVLGSRSQVFASDSPPQSLLTP    281 - 350
SRNSLNVDLYELGSTSVQQWPAATLARRDSLQKPGLEAPPRAHVAFRPDCPVPSRTNSFNSHQPRPGPPG    351 - 420
KAEPSLPAPNTVTAVTAAHILHPVKSVRVLRPEPQTAVGPSHPAWVPAPAPAPAPAPAPAAEGLDAKEEH    421 - 490
ALALGGAGAFPLDVEYGGPDRRCPPPPYPKHLLLRSKSEQYDLDSLCAGMEQSLRAGPNEPEGGDKSRKS    491 - 560
AKGDKGGKDKKQIQTSPVPVRKNSRDEEKRESRIKSYSPYAFKFFMEQHVENVIKTYQQKVNRRLQLEQE    561 - 630
MAKAGLCEAEQEQMRKILYQKESNYNRLKRAKMDKSMFVKIKTLGIGAFGEVCLACKVDTHALYAMKTLR    631 - 700
KKDVLNRNQVAHVKAERDILAEADNEWVVKLYYSFQDKDSLYFVMDYIPGGDMMSLLIRMEVFPEHLARF    701 - 770
YIAELTLAIESVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYYQKGSHVRQDSMEPSD    771 - 840
LWDDVSNCRCGDRLKTLEQRARKQHQRCLAHSLVGTPNYIAPEVLLRKGYTQLCDWWSVGVILFEMLVGQ    841 - 910
PPFLAPTPTETQLKVINWENTLHIPAQVKLSPEARDLITKLCCSADHRLGRNGADDLKAHPFFSAIDFSS    911 - 980
DIRKQPAPYVPTISHPMDTSNFDPVDEESPWNDASEGSTKAWDTLTSPNNKHPEHAFYEFTFRRFFDDNG    981 - 1050
YPFRCPKPSGAEASQAESSDLESSDLVDQTEGCQPVYV                                   1051 - 1088
//

Text Mined References (88)

PMID Year Title