Property Summary

NCBI Gene PubMed Count 71
PubMed Score 311.22
PubTator Score 73.18

Knowledge Summary

Patent (3,138)

TINX Plot

  Disease Sources (3)

Disease Target Count
astrocytoma 1493
Disease Target Count P-value
lung carcinoma 2844 1.48626738171144E-24
non-small cell lung cancer 2798 2.1472303254901E-19
glioblastoma multiforme 347 9.60515519585003E-16
juvenile dermatomyositis 1189 2.75225502503662E-13
ovarian cancer 8492 1.29246053360285E-11
lung adenocarcinoma 2714 1.87184188814158E-9
atypical teratoid / rhabdoid tumor 4369 8.94119948239239E-7
acute quadriplegic myopathy 1157 9.33912226907487E-6
primitive neuroectodermal tumor 3031 1.03231247526884E-5
pituitary cancer 1972 7.2037332483783E-5
primary pancreatic ductal adenocarcinoma 1271 1.25707390372949E-4
Pick disease 1893 1.46706460940077E-4
breast carcinoma 1614 2.03376527243401E-4
pancreatic cancer 2300 2.14690591575942E-4
invasive ductal carcinoma 2950 2.6184926394657E-4
Rheumatoid Arthritis 1171 0.00144702445830335
ductal carcinoma in situ 1745 0.003264197633656
gastric carcinoma 832 0.00444851351748146
acute myeloid leukemia 785 0.00657919336135595
adrenocortical carcinoma 1427 0.0107527541726194
active ulcerative colitis 477 0.0225161066842443
spina bifida 1064 0.0230291127318616

Expression

  Differential Expression (22)

Synonym

Accession Q9NRM7 B1AM47 Q9P2X1
Symbols KPM

Gene

PDB

4ZRI  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid
Fruitfly EggNOG Inparanoid

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (57)

PMID Text
25973055 our current data indicated a new regulatory mechanism of YAP1 by the LATS2-mediated phosphorylation that was involved in hepatocellular carcinoma tumorigenesis.
25946971 Loss of LATS2 expression is associated with lung cancer.
25841306 Both LATS1 and LATS2 were not related with the clinical variables in mucinous and clear cell carcinoma
25824045 miR-25/miR-107-LATS2 axis might play an important role in proliferation and invasion of the gastric cancer cells
25798586 Mutation in LATS2 gene is associated with malignant peritoneal mesothelioma.
25786116 Phosphorylation of CHO1 at S716 by Lats2 regulate its centrosomal localization, and that phosphorylated CHO1 interacts with and activates LIMK1 during early mitosis.
25782587 LATS2 could be induced by TNF-alpha and inhibited cell proliferation and invasion by phosphorylating YAP in OSCC cells.
25658096 Phosphorylation of S716 NDR/LATS, present only in the longest Kif23 isoform, is required for phosphorylation at S814, revealing phosphorylation at these two sites, and differential regulation of Kif23-14-3-3 interaction for the two Kif23 isoforms.
25482410 results reported here further support that LATS1/2 act normally as tumor suppressors and loss of their functions contributes to human cancer development
25391426 LATS2 was found to negatively regulate NF-kappaB signaling in NSCLC cells.
More...

AA Sequence

MRPKTFPATTYSGNSRQRLQEIREGLKQPSKSSVQGLPAGPNSDTSLDAKVLGSKDATRQQQQMRATPKF      1 - 70
GPYQKALREIRYSLLPFANESGTSAAAEVNRQMLQELVNAGCDQEMAGRALKQTGSRSIEAALEYISKMG     71 - 140
YLDPRNEQIVRVIKQTSPGKGLMPTPVTRRPSFEGTGDSFASYHQLSGTPYEGPSFGADGPTALEEMPRP    141 - 210
YVDYLFPGVGPHGPGHQHQHPPKGYGASVEAAGAHFPLQGAHYGRPHLLVPGEPLGYGVQRSPSFQSKTP    211 - 280
PETGGYASLPTKGQGGPPGAGLAFPPPAAGLYVPHPHHKQAGPAAHQLHVLGSRSQVFASDSPPQSLLTP    281 - 350
SRNSLNVDLYELGSTSVQQWPAATLARRDSLQKPGLEAPPRAHVAFRPDCPVPSRTNSFNSHQPRPGPPG    351 - 420
KAEPSLPAPNTVTAVTAAHILHPVKSVRVLRPEPQTAVGPSHPAWVPAPAPAPAPAPAPAAEGLDAKEEH    421 - 490
ALALGGAGAFPLDVEYGGPDRRCPPPPYPKHLLLRSKSEQYDLDSLCAGMEQSLRAGPNEPEGGDKSRKS    491 - 560
AKGDKGGKDKKQIQTSPVPVRKNSRDEEKRESRIKSYSPYAFKFFMEQHVENVIKTYQQKVNRRLQLEQE    561 - 630
MAKAGLCEAEQEQMRKILYQKESNYNRLKRAKMDKSMFVKIKTLGIGAFGEVCLACKVDTHALYAMKTLR    631 - 700
KKDVLNRNQVAHVKAERDILAEADNEWVVKLYYSFQDKDSLYFVMDYIPGGDMMSLLIRMEVFPEHLARF    701 - 770
YIAELTLAIESVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYYQKGSHVRQDSMEPSD    771 - 840
LWDDVSNCRCGDRLKTLEQRARKQHQRCLAHSLVGTPNYIAPEVLLRKGYTQLCDWWSVGVILFEMLVGQ    841 - 910
PPFLAPTPTETQLKVINWENTLHIPAQVKLSPEARDLITKLCCSADHRLGRNGADDLKAHPFFSAIDFSS    911 - 980
DIRKQPAPYVPTISHPMDTSNFDPVDEESPWNDASEGSTKAWDTLTSPNNKHPEHAFYEFTFRRFFDDNG    981 - 1050
YPFRCPKPSGAEASQAESSDLESSDLVDQTEGCQPVYV                                   1051 - 1088
//

Text Mined References (76)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25973055 2015 LATS2-mediated YAP1 phosphorylation is involved in HCC tumorigenesis.
25946971 2015 LATS2 inhibits the activity of NF-? B signaling by disrupting the interaction between TAK1 and IKK?.
25841306 2015 Expression of LATS family proteins in ovarian tumors and its significance.
25824045 2015 miR-107 and miR-25 simultaneously target LATS2 and regulate proliferation and invasion of gastric adenocarcinoma (GAC) cells.
25798586 2015 Personalized oncogenomics: clinical experience with malignant peritoneal mesothelioma using whole genome sequencing.
25786116 2015 Phosphorylation of CHO1 by Lats1/2 regulates the centrosomal activation of LIMK1 during cytokinesis.
25782587 2015 LATS2 induced by TNF-alpha and inhibited cell proliferation and invasion by phosphorylating YAP in oral squamous cell carcinoma.
25658096 2015 Binding of Kif23-iso1/CHO1 to 14-3-3 is regulated by sequential phosphorylations at two LATS kinase consensus sites.
25482410 2015 Mutation analysis of large tumor suppressor genes LATS1 and LATS2 supports a tumor suppressor role in human cancer.
More...