Property Summary

NCBI Gene PubMed Count 43
PubMed Score 44.30
PubTator Score 55.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

 CSPA Cell Line (2)

Gene RIF (34)

AA Sequence

MSLVLLSLAALCRSAVPREPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSW      1 - 70
VLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHN     71 - 140
IPNANMNEDGPSMSVNFTSPGCLDHIMKYKKKCVKAGSLWDPNITACKKNEETVEVNFTTTPLGNRYMAL    141 - 210
IQHSTIIGFSQVFEPHQKKQTRASVVIPVTGDSEGATVQLTPYFPTCGSDCIRHKGTVVLCPQTGVPFPL    211 - 280
DNNKSKPGGWLPLLLLSLLVATWVLVAGIYLMWRHERIKKTSFSTTTLLPPIKVLVVYPSEICFHHTICY    281 - 350
FTEFLQNHCRSEVILEKWQKKKIAEMGPVQWLATQKKAADKVVFLLSNDVNSVCDGTCGKSEGSPSENSQ    351 - 420
DLFPLAFNLFCSDLRSQIHLHKYVVVYFREIDTKDDYNALSVCPKYHLMKDATAFCAELLHVKQQVSAGK    421 - 490
RSQACHDGCCSL                                                              491 - 502
//

Text Mined References (43)

PMID Year Title