Property Summary

NCBI Gene PubMed Count 36
Grant Count 22
R01 Count 18
Funding $1,496,093.46
PubMed Score 36.59
PubTator Score 55.68

Knowledge Summary

Patent

No data available

Expression

Gene RIF (27)

PMID Text
27000993 Therefore, IL-17E/IL-17RB signaling represents a potential therapeutic target for treatment of hepatocellular carcinoma
26990986 GS is acetylated at lysines 11 and 14, yielding a degron that is necessary and sufficient for binding and ubiquitylation by CRL4(CRBN) and degradation by the proteasome.
26728744 The Breast Cancer Index (BCI) is a continuous risk index model of two previously described biomarkers: molecular grade index (MGI) and HOXB13:IL17BR (H:I) ratio
26285835 Studies indicate that interleukin 17 (IL-17B)/interleukin 17 receptor B (IL-17RB) signaling is essential for pancreatic cancer malignancy.
25732306 IL-17RB has an essential role in pancreatic cancer growth, invasion, and metastasis.
24247484 The increased IL-25 levels in plasma and the expression of IL-17RA and IL-17RB on eosinophils in allergic asthma patients suggests that IL-25 may activate eosinophils during allergic inflammation.
23851503 Results show that amplified signaling of interleukin-17 receptor B (IL-17RB) and its ligand IL-17B promot tumorigenicity in breast cancer cells and impeded acinus formation in immortalized normal mammary epithelial cells.
23497539 High IL17RB expression is associated with breast cancer.
22070932 In summary we established a new mechanism of IL17RB regulation-Smurf2 dependent degradation of its adaptor protein DAZAP2.
21570719 Allergen provocation induces functionally relevant, increased expression of IL-25 and its receptor in the asthmatic bronchial mucosa and dermis of sensitized atopic subjects.
More...

AA Sequence

MSLVLLSLAALCRSAVPREPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSW      1 - 70
VLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHN     71 - 140
IPNANMNEDGPSMSVNFTSPGCLDHIMKYKKKCVKAGSLWDPNITACKKNEETVEVNFTTTPLGNRYMAL    141 - 210
IQHSTIIGFSQVFEPHQKKQTRASVVIPVTGDSEGATVQLTPYFPTCGSDCIRHKGTVVLCPQTGVPFPL    211 - 280
DNNKSKPGGWLPLLLLSLLVATWVLVAGIYLMWRHERIKKTSFSTTTLLPPIKVLVVYPSEICFHHTICY    281 - 350
FTEFLQNHCRSEVILEKWQKKKIAEMGPVQWLATQKKAADKVVFLLSNDVNSVCDGTCGKSEGSPSENSQ    351 - 420
DLFPLAFNLFCSDLRSQIHLHKYVVVYFREIDTKDDYNALSVCPKYHLMKDATAFCAELLHVKQQVSAGK    421 - 490
RSQACHDGCCSL                                                              491 - 502
//

Text Mined References (36)

PMID Year Title
27000993 2016 Non-CSCs nourish CSCs through interleukin-17E-mediated activation of NF-?B and JAK/STAT3 signaling in human hepatocellular carcinoma.
26990986 2016 Glutamine Triggers Acetylation-Dependent Degradation of Glutamine Synthetase via the Thalidomide Receptor Cereblon.
26728744 2016 Assessment of the prognostic and predictive utility of the Breast Cancer Index (BCI): an NCIC CTG MA.14 study.
26285835 2015 Targeting interleukin-17 receptors.
25732306 2015 Targeting IL-17B-IL-17RB signaling with an anti-IL-17RB antibody blocks pancreatic cancer metastasis by silencing multiple chemokines.
24247484 2014 IL-25 and IL-25 receptor expression on eosinophils from subjects with allergic asthma.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23851503 2014 Autocrine/paracrine mechanism of interleukin-17B receptor promotes breast tumorigenesis through NF-?B-mediated antiapoptotic pathway.
23497539 2013 HOXB13:IL17BR and molecular grade index and risk of breast cancer death among patients with lymph node-negative invasive disease.
22070932 2012 Smurf2 regulates IL17RB by proteasomal degradation of its novel binding partner DAZAP2.
More...