Property Summary

NCBI Gene PubMed Count 18
Grant Count 25
R01 Count 24
Funding $2,571,933.92
PubMed Score 26.08
PubTator Score 21.10

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
25533843 CHD3.1 and ACF1-SNF2H display counteractive activities but similar histone affinities.
21745822 hACF1-containing factors are more generally involved in the DNA damage response.
21738833 ISWI proteins Snf2H, Snf2L as well as Acf1 accumulate at UV-induced DNA damage sites within tens of seconds and reach a plateau after a few minutes.
21172662 The ACF1 and its complexes play important roles in DNA double-strand breaks (DSBs) repair.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19460752 Knockdown of bromodomain adjacent to zinc finger domain, 1A (BAZ1A) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19450608 The data support a model in which the human ACF anf yeast RSC remodeling enzymes move nucleosomes to new locations by a general sequence-independent mechanism.
17519354 Has a critical role in the transcriptional repression of specific nuclear hormone receptor-regulated genes.
16877760 ACF1 alters the remodeling strategy of SNF2h

AA Sequence

MPLLHRKPFVRQKPPADLRPDEEVFYCKVTNEIFRHYDDFFERTILCNSLVWSCAVTGRPGLTYQEALES      1 - 70
EKKARQNLQSFPEPLIIPVLYLTSLTHRSRLHEICDDIFAYVKDRYFVEETVEVIRNNGARLQCRILEVL     71 - 140
PPSHQNGFANGHVNSVDGETIIISDSDDSETQSCSFQNGKKKDAIDPLLFKYKVQPTKKELHESAIVKAT    141 - 210
QISRRKHLFSRDKLKLFLKQHCEPQDGVIKIKASSLSTYKIAEQDFSYFFPDDPPTFIFSPANRRRGRPP    211 - 280
KRIHISQEDNVANKQTLASYRSKATKERDKLLKQEEMKSLAFEKAKLKREKADALEAKKKEKEDKEKKRE    281 - 350
ELKKIVEEERLKKKEEKERLKVEREKEREKLREEKRKYVEYLKQWSKPREDMECDDLKELPEPTPVKTRL    351 - 420
PPEIFGDALMVLEFLNAFGELFDLQDEFPDGVTLEVLEEALVGNDSEGPLCELLFFFLTAIFQAIAEEEE    421 - 490
EVAKEQLTDADTKDLTEALDEDADPTKSALSAVASLAAAWPQLHQGCSLKSLDLDSCTLSEILRLHILAS    491 - 560
GADVTSANAKYRYQKRGGFDATDDACMELRLSNPSLVKKLSSTSVYDLTPGEKMKILHALCGKLLTLVST    561 - 630
RDFIEDYVDILRQAKQEFRELKAEQHRKEREEAAARIRKRKEEKLKEQEQKMKEKQEKLKEDEQRNSTAD    631 - 700
ISIGEEEREDFDTSIESKDTEQKELDQDMVTEDEDDPGSHKRGRRGKRGQNGFKEFTRQEQINCVTREPL    701 - 770
TADEEEALKQEHQRKEKELLEKIQSAIACTNIFPLGRDRMYRRYWIFPSIPGLFIEEDYSGLTEDMLLPR    771 - 840
PSSFQNNVQSQDPQVSTKTGEPLMSESTSNIDQGPRDHSVQLPKPVHKPNRWCFYSSCEQLDQLIEALNS    841 - 910
RGHRESALKETLLQEKSRICAQLARFSEEKFHFSDKPQPDSKPTYSRGRSSNAYDPSQMCAEKQLELRLR    911 - 980
DFLLDIEDRIYQGTLGAIKVTDRHIWRSALESGRYELLSEENKENGIIKTVNEDVEEMEIDEQTKVIVKD    981 - 1050
RLLGIKTETPSTVSTNASTPQSVSSVVHYLAMALFQIEQGIERRFLKAPLDASDSGRSYKTVLDRWRESL   1051 - 1120
LSSASLSQVFLHLSTLDRSVIWSKSILNARCKICRKKGDAENMVLCDGCDRGHHTYCVRPKLKTVPEGDW   1121 - 1190
FCPECRPKQRSRRLSSRQRPSLESDEDVEDSMGGEDDEVDGDEEEGQSEEEEYEVEQDEDDSQEEEEVSL   1191 - 1260
PKRGRPQVRLPVKTRGKLSSSFSSRGQQQEPGRYPSRSQQSTPKTTVSSKTGRSLRKINSAPPTETKSLR   1261 - 1330
IASRSTRHSHGPLQADVFVELLSPRRKRRGRKSANNTPENSPNFPNFRVIATKSSEQSRSVNIASKLSLQ   1331 - 1400
ESESKRRCRKRQSPEPSPVTLGRRSSGRQGGVHELSAFEQLVVELVRHDDSWPFLKLVSKIQVPDYYDII   1401 - 1470
KKPIALNIIREKVNKCEYKLASEFIDDIELMFSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLHVTPS   1471 - 1540
NVDQVSTPPAAKKSRI                                                         1541 - 1556
//

Text Mined References (28)

PMID Year Title
25533843 2014 Opposing ISWI- and CHD-class chromatin remodeling activities orchestrate heterochromatic DNA repair.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21745822 2011 Role for hACF1 in the G2/M damage checkpoint.
21738833 Binding kinetics of human ISWI chromatin-remodelers to DNA repair sites elucidate their target location mechanism.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21172662 2010 The ACF1 complex is required for DNA double-strand break repair in human cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20033039 2009 The chromatin remodeller ACF acts as a dimeric motor to space nucleosomes.
More...