Property Summary

NCBI Gene PubMed Count 17
PubMed Score 136.98
PubTator Score 13.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
aldosterone-producing adenoma -1.018 2.6e-02
inflammatory breast cancer 1.100 3.7e-03
osteosarcoma -2.897 1.5e-07
ovarian cancer 1.700 6.0e-04
pancreatic ductal adenocarcinoma liver m... -1.591 1.8e-02
Rheumatoid arthritis 1.200 2.8e-02

 GO Process (1)

Gene RIF (10)

AA Sequence

MRGPPAWPLRLLEPPSPAEPGRLLPVACVWAAASRVPGSLSPFTGLRPARLWGAGPALLWGVGAARRWRS      1 - 70
GCRGGGPGASRGVLGLARLLGLWARGPGSCRCGAFAGPGAPRLPRARFPGGPAAAAWAGDEAWRRGPAAP     71 - 140
PGDKGRLRPAAAGLPEARKLLGLAYPERRRLAAAVGFLTMSSVISMSAPFFLGKIIDVIYTNPTVDYSDN    141 - 210
LTRLCLGLSAVFLCGAAANAIRVYLMQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTA    211 - 280
LLGRSVTENLSDGLRAGAQASVGISMMFFVSPNLATFVLSVVPPVSIIAVIYGRYLRKLTKVTQDSLAQA    281 - 350
TQLAEERIGNVRTVRAFGKEMTEIEKYASKVDHVMQLARKEAFARAGFFGATGLSGNLIVLSVLYKGGLL    351 - 420
MGSAHMTVGELSSFLMYAFWVGISIGGLSSFYSELMKGLGAGGRLWELLEREPKLPFNEGVILNEKSFQG    421 - 490
ALEFKNVHFAYPARPEVPIFQDFSLSIPSGSVTALVGPSGSGKSTVLSLLLRLYDPASGTISLDGHDIRQ    491 - 560
LNPVWLRSKIGTVSQEPILFSCSIAENIAYGADDPSSVTAEEIQRVAEVANAVAFIRNFPQGFNTVVGEK    561 - 630
GVLLSGGQKQRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDRLMDGRTVLVIAHRLSTIKNANM    631 - 700
VAVLDQGKITEYGKHEELLSKPNGIYRKLMNKQSFISA                                    701 - 738
//

Text Mined References (24)

PMID Year Title