Property Summary

NCBI Gene PubMed Count 15
Grant Count 4
R01 Count 4
Funding $585,804.76
PubMed Score 119.67
PubTator Score 13.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.028
osteosarcoma -2.897 0.000
pancreatic ductal adenocarcinoma liver m... -1.591 0.018
aldosterone-producing adenoma -1.018 0.026
inflammatory breast cancer 1.100 0.004
ovarian cancer 1.700 0.001

Synonym

Accession Q9NRK6 Q13040 Q6P1Q8 Q9H3V0
Symbols M-ABC2
MTABC2
EST20237

Gene

PDB

3ZDQ   4AYT   4AYW   4AYX  

Gene RIF (8)

PMID Text
23720443 ABCB10 is not a heme exporter but is required for the early mitochondrial steps of heme biosynthesis.
23716676 Data indicate that ABCB10 may exist in an open-inwards conformation when nucleotide is bound.
22884976 ABCB10 is required for primitive erythropoiesis and to protect from oxidative stress associated with cardiac ischemia-reperfusion in mice. Antioxidants can rescue the defects associated with ABCB10 loss-of-function in mice.
22085049 Human mitochondrial ATP-binding cassette transporter ABCB10 is required for efficient red blood cell development.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19151771 mutations in ABCB8 and ABCB10 is not associated with acute myeloid leukemia.
15215243 study of ABCB10 targeting, import, and dimerization

AA Sequence

MRGPPAWPLRLLEPPSPAEPGRLLPVACVWAAASRVPGSLSPFTGLRPARLWGAGPALLWGVGAARRWRS      1 - 70
GCRGGGPGASRGVLGLARLLGLWARGPGSCRCGAFAGPGAPRLPRARFPGGPAAAAWAGDEAWRRGPAAP     71 - 140
PGDKGRLRPAAAGLPEARKLLGLAYPERRRLAAAVGFLTMSSVISMSAPFFLGKIIDVIYTNPTVDYSDN    141 - 210
LTRLCLGLSAVFLCGAAANAIRVYLMQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTA    211 - 280
LLGRSVTENLSDGLRAGAQASVGISMMFFVSPNLATFVLSVVPPVSIIAVIYGRYLRKLTKVTQDSLAQA    281 - 350
TQLAEERIGNVRTVRAFGKEMTEIEKYASKVDHVMQLARKEAFARAGFFGATGLSGNLIVLSVLYKGGLL    351 - 420
MGSAHMTVGELSSFLMYAFWVGISIGGLSSFYSELMKGLGAGGRLWELLEREPKLPFNEGVILNEKSFQG    421 - 490
ALEFKNVHFAYPARPEVPIFQDFSLSIPSGSVTALVGPSGSGKSTVLSLLLRLYDPASGTISLDGHDIRQ    491 - 560
LNPVWLRSKIGTVSQEPILFSCSIAENIAYGADDPSSVTAEEIQRVAEVANAVAFIRNFPQGFNTVVGEK    561 - 630
GVLLSGGQKQRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDRLMDGRTVLVIAHRLSTIKNANM    631 - 700
VAVLDQGKITEYGKHEELLSKPNGIYRKLMNKQSFISA                                    701 - 738
//

Text Mined References (22)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23720443 2013 ATP-binding cassette B10 regulates early steps of heme synthesis.
23716676 2013 Structures of ABCB10, a human ATP-binding cassette transporter in apo- and nucleotide-bound states.
23620142 2013 Genome-wide and gene-centric analyses of circulating myeloperoxidase levels in the charge and care consortia.
22884976 2012 Mitochondrial ABC transporters function: the role of ABCB10 (ABC-me) as a novel player in cellular handling of reactive oxygen species.
22085049 2012 Human mitochondrial ATP-binding cassette transporter ABCB10 is required for efficient red blood cell development.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...