Property Summary

NCBI Gene PubMed Count 15
PubMed Score 119.67
PubTator Score 13.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Expression

  Differential Expression (6)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.028
osteosarcoma -2.897 0.000
pancreatic ductal adenocarcinoma liver m... -1.591 0.018
aldosterone-producing adenoma -1.018 0.026
inflammatory breast cancer 1.100 0.004
ovarian cancer 1.700 0.001

Synonym

Accession Q9NRK6 Q13040 Q6P1Q8 Q9H3V0
Symbols M-ABC2
MTABC2
EST20237

Gene

PDB

3ZDQ   4AYT   4AYW   4AYX  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (8)

PMID Text
23720443 ABCB10 is not a heme exporter but is required for the early mitochondrial steps of heme biosynthesis.
23716676 Data indicate that ABCB10 may exist in an open-inwards conformation when nucleotide is bound.
22884976 ABCB10 is required for primitive erythropoiesis and to protect from oxidative stress associated with cardiac ischemia-reperfusion in mice. Antioxidants can rescue the defects associated with ABCB10 loss-of-function in mice.
22085049 Human mitochondrial ATP-binding cassette transporter ABCB10 is required for efficient red blood cell development.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19151771 mutations in ABCB8 and ABCB10 is not associated with acute myeloid leukemia.
15215243 study of ABCB10 targeting, import, and dimerization

AA Sequence

MRGPPAWPLRLLEPPSPAEPGRLLPVACVWAAASRVPGSLSPFTGLRPARLWGAGPALLWGVGAARRWRS      1 - 70
GCRGGGPGASRGVLGLARLLGLWARGPGSCRCGAFAGPGAPRLPRARFPGGPAAAAWAGDEAWRRGPAAP     71 - 140
PGDKGRLRPAAAGLPEARKLLGLAYPERRRLAAAVGFLTMSSVISMSAPFFLGKIIDVIYTNPTVDYSDN    141 - 210
LTRLCLGLSAVFLCGAAANAIRVYLMQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTA    211 - 280
LLGRSVTENLSDGLRAGAQASVGISMMFFVSPNLATFVLSVVPPVSIIAVIYGRYLRKLTKVTQDSLAQA    281 - 350
TQLAEERIGNVRTVRAFGKEMTEIEKYASKVDHVMQLARKEAFARAGFFGATGLSGNLIVLSVLYKGGLL    351 - 420
MGSAHMTVGELSSFLMYAFWVGISIGGLSSFYSELMKGLGAGGRLWELLEREPKLPFNEGVILNEKSFQG    421 - 490
ALEFKNVHFAYPARPEVPIFQDFSLSIPSGSVTALVGPSGSGKSTVLSLLLRLYDPASGTISLDGHDIRQ    491 - 560
LNPVWLRSKIGTVSQEPILFSCSIAENIAYGADDPSSVTAEEIQRVAEVANAVAFIRNFPQGFNTVVGEK    561 - 630
GVLLSGGQKQRIAIARALLKNPKILLLDEATSALDAENEYLVQEALDRLMDGRTVLVIAHRLSTIKNANM    631 - 700
VAVLDQGKITEYGKHEELLSKPNGIYRKLMNKQSFISA                                    701 - 738
//

Text Mined References (22)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23720443 2013 ATP-binding cassette B10 regulates early steps of heme synthesis.
23716676 2013 Structures of ABCB10, a human ATP-binding cassette transporter in apo- and nucleotide-bound states.
23620142 2013 Genome-wide and gene-centric analyses of circulating myeloperoxidase levels in the charge and care consortia.
22884976 2012 Mitochondrial ABC transporters function: the role of ABCB10 (ABC-me) as a novel player in cellular handling of reactive oxygen species.
22085049 2012 Human mitochondrial ATP-binding cassette transporter ABCB10 is required for efficient red blood cell development.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...