Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.14
PubTator Score 0.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
group 4 medulloblastoma 1875 2.16113570725684E-7
astrocytoma 1493 7.37985026520925E-7
pilocytic astrocytoma 3086 1.19520434026252E-5
ovarian cancer 8492 1.16252979881608E-4
adult high grade glioma 2148 1.18092923165896E-4
Breast cancer 3099 3.27295407096847E-4
medulloblastoma, large-cell 6234 6.3377688887891E-4
glioblastoma 5572 0.00119025384077989
Pick disease 1893 0.00145973125310164
oligodendroglioma 2849 0.0111518763990357
primitive neuroectodermal tumor 3031 0.0147822804894417
atypical teratoid / rhabdoid tumor 4369 0.0186460090816747
invasive ductal carcinoma 2950 0.0435029036801842
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Synonym

Accession Q9NRJ7 B3KPK5 Q8IYD5 Q96SE9 Q9HCF1 PCDH-beta-16
Symbols ME1
PCDH3X
PCDHB8a
PCDH-BETA16

Gene

PANTHER Protein Class (2)

  Ortholog (3)

Species Source
Chimp OMA Inparanoid
Mouse OMA Inparanoid
Cow OMA Inparanoid

AA Sequence

MEIGWMHNRRQRQVLVFFVLLSLSGAGAELGSYSVVEETERGSFVANLGKDLGLGLTEMSTRKARIISQG      1 - 70
NKQHLQLKAQTGDLLINEKLDREELCGPTEPCILHFQVLMENPLEIFQAELRVIDINDHSPMFTEKEMIL     71 - 140
KIPENSPLGTEFPLNHALDLDVGSNNVQNYKISPSSHFRVLIHEFRDGRKYPELVLDKELDREEEPQLRL    141 - 210
TLTALDGGSPPRSGTAQVRIEVVDINDNAPEFEQPIYKVQIPENSPLGSLVATVSARDLDGGANGKISYT    211 - 280
LFQPSEDISKTLEVNPMTGEVRLRKQVDFEMVTSYEVRIKATDGGGLSGKCTLLLQVVDVNDNPPQVTMS    281 - 350
ALTSPIPENSPEIVVAVFSVSDPDSGNNGKTISSIQEDLPFLLKPSVKNFYTLVTERALDREARAEYNIT    351 - 420
LTVTDMGTPRLKTEHNITVQISDVNDNAPTFTQTSYTLFVRENNSPALHIGSVSATDRDSGTNAQVTYSL    421 - 490
LPPQDPHLPLASLVSINADNGHLFALRSLDYEALREFEFRVSATDRGSPALSSEALVRVLVLDANDNSPF    491 - 560
VLYPLQNGSAPCTELVPRAAEPGYLVTKVVAVDGDSGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLL    561 - 630
SERDAAKQRLVVLVKDNGEPPRSATATLHVLLVDGFSQPFLPLPEAAPGQTQANSLTVYLVVALASVSSL    631 - 700
FLFSVLLFVAVRLCRRSRAASVGRCSMPEGPFPGRLVDVSGTGTLSQSYQYEVCLTGGSETSEFKFLKPI    701 - 770
IPNFSP                                                                    771 - 776
//

Text Mined References (14)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12231349 2002 Protocadherins.
11322959 2001 The human and murine protocadherin-beta one-exon gene families show high evolutionary conservation, despite the difference in gene number.
11230163 2001 Comparative DNA sequence analysis of mouse and human protocadherin gene clusters.
10997877 2000 Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
10835267 2000 Phylogenetic analysis of the cadherin superfamily allows identification of six major subfamilies besides several solitary members.
More...