Property Summary

NCBI Gene PubMed Count 10
PubMed Score 12.70
PubTator Score 2.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 4.4761220525207E-24
Amyotrophic Lateral Sclerosis 432 5.21669420568648E-9
osteosarcoma 7933 9.63506157533614E-8
Pick disease 1893 1.27814943056437E-6
psoriasis 6685 1.3675078962016E-5
pituitary cancer 1972 7.13308501250295E-5
ovarian cancer 8492 1.18534664158239E-4
medulloblastoma, large-cell 6234 4.51043653234369E-4
pilocytic astrocytoma 3086 0.0012371704381356
Rheumatoid Arthritis 1171 0.00144702445830335
atypical teratoid / rhabdoid tumor 4369 0.00292667030339558
glioblastoma 5572 0.00321013712998366
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0033341466456085
pediatric high grade glioma 2712 0.00824178518192549
ependymoma 2514 0.00952287053675112
subependymal giant cell astrocytoma 2287 0.0187834530827002
medulloblastoma 1524 0.0189712450502004
astrocytic glioma 2241 0.0225564540935609
Breast cancer 3099 0.024985428675843
Alzheimer's disease 644 0.0347084435399607
oligodendroglioma 2849 0.0462537314995716
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (21)

Disease log2 FC p
Rheumatoid Arthritis 1.700 0.001
astrocytic glioma -1.600 0.023
ependymoma -2.100 0.010
oligodendroglioma -1.300 0.046
psoriasis -3.100 0.000
glioblastoma -2.300 0.003
osteosarcoma 3.302 0.000
atypical teratoid / rhabdoid tumor -2.300 0.003
medulloblastoma -1.600 0.019
medulloblastoma, large-cell -3.100 0.000
Amyotrophic Lateral Sclerosis 1.181 0.000
intraductal papillary-mucinous neoplasm ... -1.100 0.003
Breast cancer 3.700 0.025
pediatric high grade glioma -1.600 0.008
pilocytic astrocytoma -1.700 0.001
subependymal giant cell astrocytoma -1.749 0.019
lung carcinoma 1.500 0.000
Alzheimer's disease 1.300 0.035
Pick disease 1.800 0.000
ovarian cancer 1.800 0.000
pituitary cancer -2.100 0.000

Synonym

Accession Q9NRJ4 Q5T3M2 Q5T3M3 Q9HD22 Q9P2F0
Symbols TUSP

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG
Fruitfly EggNOG Inparanoid

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MYAAVEHGPVLCSDSNILCLSWKGRVPKSEKEKPVCRRRYYEEGWLATGNGRGVVGVTFTSSHCRRDRST      1 - 70
PQRINFNLRGHNSEVVLVRWNEPYQKLATCDADGGIFVWIQYEGRWSVELVNDRGAQVSDFTWSHDGTQA     71 - 140
LISYRDGFVLVGSVSGQRHWSSEINLESQITCGIWTPDDQQVLFGTADGQVIVMDCHGRMLAHVLLHESD    141 - 210
GVLGMSWNYPIFLVEDSSESDTDSDDYAPPQDGPAAYPIPVQNIKPLLTVSFTSGDISLMNNYDDLSPTV    211 - 280
IRSGLKEVVAQWCTQGDLLAVAGMERQTQLGELPNGPLLKSAMVKFYNVRGEHIFTLDTLVQRPIISICW    281 - 350
GHRDSRLLMASGPALYVVRVEHRVSSLQLLCQQAIASTLREDKDVSKLTLPPRLCSYLSTAFIPTIKPPI    351 - 420
PDPNNMRDFVSYPSAGNERLHCTMKRTEDDPEVGGPCYTLYLEYLGGLVPILKGRRISKLRPEFVIMDPR    421 - 490
TDSKPDEIYGNSLISTVIDSCNCSDSSDIELSDDWAAKKSPKISRASKSPKLPRISIEARKSPKLPRAAQ    491 - 560
ELSRSPRLPLRKPSVGSPSLTRREFPFEDITQHNYLAQVTSNIWGTKFKIVGLAAFLPTNLGAVIYKTSL    561 - 630
LHLQPRQMTIYLPEVRKISMDYINLPVFNPNVFSEDEDDLPVTGASGVPENSPPCTVNIPIAPIHSSAQA    631 - 700
MSPTQSIGLVQSLLANQNVQLDVLTNQTTAVGTAEHAGDSATQYPVSNRYSNPGQVIFGSVEMGRIIQNP    701 - 770
PPLSLPPPPQGPMQLSTVGHGDRDHEHLQKSAKALRPTPQLAAEGDAVVFSAPQEVQVTKINPPPPYPGT    771 - 840
IPAAPTTAAPPPPLPPPQPPVDVCLKKGDFSLYPTSVHYQTPLGYERITTFDSSGNVEEVCRPRTRMLCS    841 - 910
QNTYTLPGPGSSATLRLTATEKKVPQPCSSATLNRLTVPRYSIPTGDPPPYPEIASQLAQGRGAAQRSDN    911 - 980
SLIHATLRRNNREATLKMAQLADSPRAPLQPLAKSKGGPGGVVTQLPARPPPALYTCSQCSGTGPSSQPG    981 - 1050
ASLAHTASASPLASQSSYSLLSPPDSARDRTDYVNSAFTEDEALSQHCQLEKPLRHPPLPEAAVTLKRPP   1051 - 1120
PYQWDPMLGEDVWVPQERTAQTSGPNPLKLSSLMLSQGQHLDVSRLPFISPKSPASPTATFQTGYGMGVP   1121 - 1190
YPGSYNNPPLPGVQAPCSPKDALSPTQFAQQEPAVVLQPLYPPSLSYCTLPPMYPGSSTCSSLQLPPVAL   1191 - 1260
HPWSSYSACPPMQNPQGTLPPKPHLVVEKPLVSPPPADLQSHLGTEVMVETADNFQEVLSLTESPVPQRT   1261 - 1330
EKFGKKNRKRLDSRAEEGSVQAITEGKVKKEARTLSDFNSLISSPHLGREKKKVKSQKDQLKSKKLNKTN   1331 - 1400
EFQDSSESEPELFISGDELMNQSQGSRKGWKSKRSPRAAGELEEAKCRRASEKEDGRLGSQGFVYVMANK   1401 - 1470
QPLWNEATQVYQLDFGGRVTQESAKNFQIELEGRQVMQFGRIDGSAYILDFQYPFSAVQAFAVALANVTQ   1471 - 1540
RLK                                                                      1541 - 1543
//

Text Mined References (13)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12076535 2002 The SOCS box: a tale of destruction and degradation.
More...