Property Summary

NCBI Gene PubMed Count 10
PubMed Score 13.99
PubTator Score 2.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -1.300 2.2e-06
Alzheimer's disease 1.300 3.5e-02
Amyotrophic lateral sclerosis 1.181 5.2e-09
astrocytic glioma -1.600 2.3e-02
Astrocytoma, Pilocytic -1.700 1.4e-03
atypical teratoid / rhabdoid tumor -1.500 1.8e-06
Breast cancer 3.700 2.5e-02
ependymoma -1.800 1.9e-02
glioblastoma -1.300 2.6e-07
intraductal papillary-mucinous neoplasm ... -1.100 3.3e-03
lung carcinoma 1.500 4.5e-24
medulloblastoma -1.600 1.9e-02
medulloblastoma, large-cell -1.500 1.8e-04
oligodendroglioma -1.300 4.6e-02
osteosarcoma -2.221 6.9e-06
ovarian cancer 1.800 1.2e-04
Pick disease 1.800 1.3e-06
pituitary cancer -2.100 7.1e-05
psoriasis -3.100 1.4e-05
Rheumatoid arthritis 1.700 1.4e-03
subependymal giant cell astrocytoma -1.267 2.6e-03

Gene RIF (1)

AA Sequence

MYAAVEHGPVLCSDSNILCLSWKGRVPKSEKEKPVCRRRYYEEGWLATGNGRGVVGVTFTSSHCRRDRST      1 - 70
PQRINFNLRGHNSEVVLVRWNEPYQKLATCDADGGIFVWIQYEGRWSVELVNDRGAQVSDFTWSHDGTQA     71 - 140
LISYRDGFVLVGSVSGQRHWSSEINLESQITCGIWTPDDQQVLFGTADGQVIVMDCHGRMLAHVLLHESD    141 - 210
GVLGMSWNYPIFLVEDSSESDTDSDDYAPPQDGPAAYPIPVQNIKPLLTVSFTSGDISLMNNYDDLSPTV    211 - 280
IRSGLKEVVAQWCTQGDLLAVAGMERQTQLGELPNGPLLKSAMVKFYNVRGEHIFTLDTLVQRPIISICW    281 - 350
GHRDSRLLMASGPALYVVRVEHRVSSLQLLCQQAIASTLREDKDVSKLTLPPRLCSYLSTAFIPTIKPPI    351 - 420
PDPNNMRDFVSYPSAGNERLHCTMKRTEDDPEVGGPCYTLYLEYLGGLVPILKGRRISKLRPEFVIMDPR    421 - 490
TDSKPDEIYGNSLISTVIDSCNCSDSSDIELSDDWAAKKSPKISRASKSPKLPRISIEARKSPKLPRAAQ    491 - 560
ELSRSPRLPLRKPSVGSPSLTRREFPFEDITQHNYLAQVTSNIWGTKFKIVGLAAFLPTNLGAVIYKTSL    561 - 630
LHLQPRQMTIYLPEVRKISMDYINLPVFNPNVFSEDEDDLPVTGASGVPENSPPCTVNIPIAPIHSSAQA    631 - 700
MSPTQSIGLVQSLLANQNVQLDVLTNQTTAVGTAEHAGDSATQYPVSNRYSNPGQVIFGSVEMGRIIQNP    701 - 770
PPLSLPPPPQGPMQLSTVGHGDRDHEHLQKSAKALRPTPQLAAEGDAVVFSAPQEVQVTKINPPPPYPGT    771 - 840
IPAAPTTAAPPPPLPPPQPPVDVCLKKGDFSLYPTSVHYQTPLGYERITTFDSSGNVEEVCRPRTRMLCS    841 - 910
QNTYTLPGPGSSATLRLTATEKKVPQPCSSATLNRLTVPRYSIPTGDPPPYPEIASQLAQGRGAAQRSDN    911 - 980
SLIHATLRRNNREATLKMAQLADSPRAPLQPLAKSKGGPGGVVTQLPARPPPALYTCSQCSGTGPSSQPG    981 - 1050
ASLAHTASASPLASQSSYSLLSPPDSARDRTDYVNSAFTEDEALSQHCQLEKPLRHPPLPEAAVTLKRPP   1051 - 1120
PYQWDPMLGEDVWVPQERTAQTSGPNPLKLSSLMLSQGQHLDVSRLPFISPKSPASPTATFQTGYGMGVP   1121 - 1190
YPGSYNNPPLPGVQAPCSPKDALSPTQFAQQEPAVVLQPLYPPSLSYCTLPPMYPGSSTCSSLQLPPVAL   1191 - 1260
HPWSSYSACPPMQNPQGTLPPKPHLVVEKPLVSPPPADLQSHLGTEVMVETADNFQEVLSLTESPVPQRT   1261 - 1330
EKFGKKNRKRLDSRAEEGSVQAITEGKVKKEARTLSDFNSLISSPHLGREKKKVKSQKDQLKSKKLNKTN   1331 - 1400
EFQDSSESEPELFISGDELMNQSQGSRKGWKSKRSPRAAGELEEAKCRRASEKEDGRLGSQGFVYVMANK   1401 - 1470
QPLWNEATQVYQLDFGGRVTQESAKNFQIELEGRQVMQFGRIDGSAYILDFQYPFSAVQAFAVALANVTQ   1471 - 1540
RLK                                                                      1541 - 1543
//

Text Mined References (13)

PMID Year Title