Property Summary

NCBI Gene PubMed Count 37
PubMed Score 133.40
PubTator Score 321.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Breast cancer -5.500 2.9e-34
breast carcinoma -2.000 8.3e-18
chronic rhinosinusitis 1.457 2.6e-02
cystic fibrosis 1.246 1.4e-05
facioscapulohumeral dystrophy 1.700 2.1e-02
invasive ductal carcinoma -1.868 1.5e-02
medulloblastoma -1.100 3.0e-04
osteosarcoma -1.541 9.2e-03
ovarian cancer 1.100 1.4e-04
tuberculosis and treatment for 6 months 1.300 6.0e-04

Protein-protein Interaction (1)

Gene RIF (22)

AA Sequence

MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRR      1 - 70
RICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY                  71 - 127
//

Text Mined References (38)

PMID Year Title