Property Summary

NCBI Gene PubMed Count 37
Grant Count 48
R01 Count 28
Funding $8,435,300.98
PubMed Score 130.93
PubTator Score 321.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.541 0.009
cystic fibrosis -1.400 0.000
medulloblastoma -1.100 0.000
tuberculosis and treatment for 6 months 1.300 0.001
invasive ductal carcinoma -1.868 0.015
Breast cancer -5.500 0.000
breast carcinoma -2.000 0.000
ovarian cancer 1.100 0.000
chronic rhinosinusitis 1.457 0.026
facioscapulohumeral dystrophy 1.700 0.021

Gene RIF (22)

PMID Text
26642722 disease severity of atopic dermatitis in children is not correlated to the level of CCL28, but rather related to that of total IgE
25740824 High CCL28 gene methylation is associated with gastric tumor aggressiveness.
25567740 CCL28 was absent in saliva of primary Sjogren's syndrome patients. This finding did not correlate with salivary IgA levels.
24917456 CCL28-CCR3 interactions are involved in the homeostatic trafficking of CD4(+) T cells to the upper airways.
23509159 CCL28 is a potent growth-promoting factor with the ability to support the in vitro and in vivo functional properties of cultured human hematopoietic cells.
21753853 tumour hypoxia promotes the recruitment of regulatory T (T(reg)) cells through induction of expression of the chemokine CC-chemokine ligand 28 (CCL28), which, in turn, promotes tumour tolerance and angiogenesis
21447959 These results indicate a role for IL-17A in the human lung by enhancing the expression of CCL28 and hence driving the recruitment of IgE-secreting B cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRR      1 - 70
RICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY                  71 - 127
//

Text Mined References (38)

PMID Year Title
26642722 2015 CCL28 Cannot Replace IgE for Severity by Objective SCORAD Index in Atopic Dermatitis in Children.
25740824 2015 Epigenetic clustering of gastric carcinomas based on DNA methylation profiles at the precancerous stage: its correlation with tumor aggressiveness and patient outcome.
25567740 2015 Absence of salivary CCL28 in primary Sjögren's syndrome.
25416956 2014 A proteome-scale map of the human interactome network.
24917456 2015 A role for CCL28-CCR3 in T-cell homing to the human upper airway mucosa.
23934736 2013 Genome-wide association study of a heart failure related metabolomic profile among African Americans in the Atherosclerosis Risk in Communities (ARIC) study.
23509159 2013 Identification of the chemokine CCL28 as a growth and survival factor for human hematopoietic stem and progenitor cells.
21753853 2011 Tumour hypoxia promotes tolerance and angiogenesis via CCL28 and T(reg) cells.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21447959 2011 IL-17A induces CCL28, supporting the chemotaxis of IgE-secreting B cells.
More...