Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Synonym

Accession Q9NRJ2
Symbols MOST2
C9orf31

Gene

 Compartment GO Term (1)

AA Sequence

MTHPLPHDSHTSGAPPLVNKSRDLANGPPFFSPLQSLWEEFLHLLFMGTLLFYRIATKALRGKATLLKSH      1 - 70
SKQPAQPGWEPGIRAPSPVPASSLQDHSRLTSLSRTGKEQRRTLSLIRKTSGTPTESTVATAAASTTEVP     71 - 140
SRLPWAARAGFKRTTGVCIALPT                                                   141 - 163
//

Text Mined References (1)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.