Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.0e-11
Disease Target Count Z-score Confidence
Cycloplegia 12 3.32 1.7
alpha-mannosidosis 8 3.225 1.6

Expression

Synonym

Accession Q9NRJ2
Symbols MOST2
C9orf31

Gene

 Compartment GO Term (1)

AA Sequence

MTHPLPHDSHTSGAPPLVNKSRDLANGPPFFSPLQSLWEEFLHLLFMGTLLFYRIATKALRGKATLLKSH      1 - 70
SKQPAQPGWEPGIRAPSPVPASSLQDHSRLTSLSRTGKEQRRTLSLIRKTSGTPTESTVATAAASTTEVP     71 - 140
SRLPWAARAGFKRTTGVCIALPT                                                   141 - 163
//

Text Mined References (1)

PMID Year Title