Property Summary

NCBI Gene PubMed Count 4
PubMed Score 9.18
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
17143515 MOST-1 is associated with cell survival, proliferation and progression of breast and prostate cancer cells.
12665628 MOST-1 (C8orf17) gene exhibits tissue specific expression, maps to chromosome 8q24.2, overexpressed/amplified in high grade cancers of the breast and prostate; suggesting a role for MOST-1 in proliferation and carcinogenesis.

AA Sequence

MGECPHLVDVRLGHRSLATGPEQSDICHTGSEARWTTTWYGSLSFSRHKYKMLADLTPGVEMSCRHWARW      1 - 70
LTPVIPALWKAEAGGLPELRSSRPAWTTW                                              71 - 99
//

Text Mined References (4)

PMID Year Title
18000363 2007 High-resolution array comparative genomic hybridization of chromosome 8q: evaluation of putative progression markers for gastroesophageal junction adenocarcinomas.
17143515 2007 Cellular expression, localization and interactions of the product of the human MOST-1 gene associated with breast and prostate cancers.
12665628 2003 The novel human MOST-1 (C8orf17) gene exhibits tissue specific expression, maps to chromosome 8q24.2, and is overexpressed/amplified in high grade cancers of the breast and prostate.
11181995 2001 The sequence of the human genome.