Property Summary

NCBI Gene PubMed Count 4
PubMed Score 10.18
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Gene RIF (2)

AA Sequence

MGECPHLVDVRLGHRSLATGPEQSDICHTGSEARWTTTWYGSLSFSRHKYKMLADLTPGVEMSCRHWARW      1 - 70
LTPVIPALWKAEAGGLPELRSSRPAWTTW                                              71 - 99
//

Text Mined References (4)

PMID Year Title