Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 1.50

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
lung adenocarcinoma 2714 0.0015535609025673


Gene RIF (1)

15855352 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MATVLLALLVYLGALVDAYPIKPEAPGEDAFLG                                           1 - 33

Text Mined References (4)

PMID Year Title
15855352 2005 Variations in peptide YY and Y2 receptor genes are associated with severe obesity in Pima Indian men.
11825642 2002 The origin and evolution of peptide YY (PYY) and pancreatic polypeptide (PP).
10756099 2000 Peptide YY-2 (PYY2) and pancreatic polypeptide-2 (PPY2): species-specific evolution of novel members of the neuropeptide Y gene family.
7831336 1995 Seminalplasmin: recent evolution of another member of the neuropeptide Y gene family.