Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung adenocarcinoma 2716 1.6e-03

Expression

Gene RIF (1)

AA Sequence

MATVLLALLVYLGALVDAYPIKPEAPGEDAFLG                                           1 - 33
//

Text Mined References (4)

PMID Year Title