Property Summary

NCBI Gene PubMed Count 220
Grant Count 186
R01 Count 52
Funding $33,100,865.14
PubMed Score 270.65
PubTator Score 390.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
cutaneous lupus erythematosus 1.500 0.011
lung cancer 3.000 0.000

Gene

Gene RIF (236)

PMID Text
27333658 It is anterogradely transported to the neurite tips, together with Lis1, and functions in neurite extension via suppression of GSK3beta activity.
26615762 Hypoxic preconditioning decreases NF-kappaB activity via DISC1.
26553875 DISC1 acts as an important regulator of mitochondrial dynamics in both axons and dendrites.
26546129 These results uncover an unexpected role for DISC1 in normal beta-cell physiology and suggest that DISC1 dysregulation contributes to T2D independently of its importance for cognition.
26443054 DISC1 gene variations may affect the course of cognitive deficits found in patients suffering from the first episode of non-affective psychosis
26299970 DISC1 disruption affects expression of neural cell fate markers and Wnt signaling.
26206934 Transient neonatal disruption of signaling via the C-terminal domain of "disrupted in schizophrenia 1" (DISC1)-a molecule implicated in psychiatric disorders-resulted in a lack of long-term potentiation (LTP) (persistent strengthening of synapses) and experience-dependent potentiation in adulthood.
26162659 An association was found with DISC1 genetic variants and susceptibility to schizophrenia in a Han Chinese population.
26078884 Results indicate that the neurexin and neuroligin synaptic complex is intrinsically involved in the regulation of DISC1 function, thus contributing to a better understanding of the pathology of schizophrenia.
26062786 Results suggest that DISC1 interacts with BACE1 and promotes lysosomal degradation of BACE1, thus reducing the generation of Abeta
More...

AA Sequence

MPGGGPQGAPAAAGGGGVSHRAGSRDCLPPAACFRRRRLARRPGYMRSSTGPGIGFLSPAVGTLFRFPGG      1 - 70
VSGEESHHSESRARQCGLDSRGLLVRSPVSKSAAAPTVTSVRGTSAHFGIQLRGGTRLPDRLSWPCGPGS     71 - 140
AGWQQEFAAMDSSETLDASWEAACSDGARRVRAAGSLPSAELSSNSCSPGCGPEVPPTPPGSHSAFTSSF    141 - 210
SFIRLSLGSAGERGEAEGCPPSREAESHCQSPQEMGAKAASLDGPHEDPRCLSRPFSLLATRVSADLAQA    211 - 280
ARNSSRPERDMHSLPDMDPGSSSSLDPSLAGCGGDGSSGSGDAHSWDTLLRKWEPVLRDCLLRNRRQMEV    281 - 350
ISLRLKLQKLQEDAVENDDYDKAETLQQRLEDLEQEKISLHFQLPSRQPALSSFLGHLAAQVQAALRRGA    351 - 420
TQQASGDDTHTPLRMEPRLLEPTAQDSLHVSITRRDWLLQEKQQLQKEIEALQARMFVLEAKDQQLRREI    421 - 490
EEQEQQLQWQGCDLTPLVGQLSLGQLQEVSKALQDTLASAGQIPFHAEPPETIRSLQERIKSLNLSLKEI    491 - 560
TTKVCMSEKFCSTLRKKVNDIETQLPALLEAKMHAISGNHFWTAKDLTEEIRSLTSEREGLEGLLSKLLV    561 - 630
LSSRNVKKLGSVKEDYNRLRREVEHQETAYETSVKENTMKYMETLKNKLCSCKCPLLGKVWEADLEACRL    631 - 700
LIQSLQLQEARGSLSVEDERQMDDLEGAAPPIPPRLHSEDKRKTPLKVLEEWKTHLIPSLHCAGGEQKEE    701 - 770
SYILSAELGEKCEDIGKKLLYLEDQLHTAIHSHDEDLIQSLRRELQMVKETLQAMILQLQPAKEAGEREA    771 - 840
AASCMTAGVHEAQA                                                            841 - 854
//

Text Mined References (220)

PMID Year Title
27333658 2016 [When we have learned about the brain development from a disease-oriented study: DBZ regulates cortical cell positioning and neurite extension by sustaining the anterograde transport of Lis1/DISC1 through control of Ndel1 phosphorylation].
26615762 2016 Hypoxic preconditioning decreases nuclear factor ?B activity via Disrupted in Schizophrenia-1.
26553875 2016 DISC1-dependent Regulation of Mitochondrial Dynamics Controls the Morphogenesis of Complex Neuronal Dendrites.
26546129 2016 Beyond the brain: disrupted in schizophrenia 1 regulates pancreatic ?-cell function via glycogen synthase kinase-3?.
26443054 2015 Effect of DISC1 polymorphisms on the long-term course of neurocognitive deficits in non-affective psychosis.
26299970 2015 Genomic DISC1 Disruption in hiPSCs Alters Wnt Signaling and Neural Cell Fate.
26206934 2015 NEURODEVELOPMENT. Adult cortical plasticity depends on an early postnatal critical period.
26162659 2015 New findings support the association of DISC1 genetic variants with susceptibility to schizophrenia in the Han Chinese population.
26078884 2015 Neurexin-Neuroligin Synaptic Complex Regulates Schizophrenia-Related DISC1/Kal-7/Rac1 "Signalosome".
26062786 2016 Disrupted-in-Schizophrenia-1 Attenuates Amyloid-? Generation and Cognitive Deficits in APP/PS1 Transgenic Mice by Reduction of ?-Site APP-Cleaving Enzyme 1 Levels.
More...