Tdark | Tubulin gamma-2 chain |
Tubulin is the major constituent of microtubules. The gamma chain is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome. Pericentriolar matrix component that regulates alpha/beta chain minus-end nucleation, centrosome duplication and spindle formation (By similarity).
Comments
Disease | Target Count | P-value |
---|---|---|
ependymoma | 2514 | 6.22160924679176E-12 |
atypical teratoid / rhabdoid tumor | 4369 | 1.03811084491227E-8 |
pediatric high grade glioma | 2712 | 1.71805171508325E-7 |
sonic hedgehog group medulloblastoma | 1482 | 2.61304016280124E-7 |
medulloblastoma, large-cell | 6234 | 1.31085653320541E-6 |
Pick disease | 1893 | 5.64691888540355E-6 |
glioblastoma | 5572 | 1.38476730512511E-5 |
interstitial cystitis | 2299 | 8.61078038306127E-5 |
primitive neuroectodermal tumor | 3031 | 1.53970222579321E-4 |
osteosarcoma | 7933 | 0.00235313110546369 |
subependymal giant cell astrocytoma | 2287 | 0.0143728846424492 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
pilocytic astrocytoma | 3086 | 3.361 | 1.7 |
Disease | log2 FC | p |
---|---|---|
osteosarcoma | -1.173 | 0.002 |
ependymoma | -1.800 | 0.000 |
glioblastoma | -2.200 | 0.000 |
sonic hedgehog group medulloblastoma | -2.400 | 0.000 |
atypical teratoid / rhabdoid tumor | -2.000 | 0.000 |
medulloblastoma, large-cell | -3.200 | 0.000 |
primitive neuroectodermal tumor | -1.400 | 0.000 |
interstitial cystitis | -1.400 | 0.000 |
pediatric high grade glioma | -2.100 | 0.000 |
pilocytic astrocytoma | -1.300 | 0.000 |
subependymal giant cell astrocytoma | -1.429 | 0.014 |
Pick disease | -1.500 | 0.000 |
PMID | Text |
---|---|
23826228 | HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type |
22806905 | Our results reveal for the first time an increased expression of TUBG1 and TUBG2 in lung cancer |
22235350 | gamma-tubulin 2 is able to nucleate microtubules and substitute for gamma-tubulin 1 |
20508983 | Observational study of gene-disease association. (HuGE Navigator) |
15698476 | HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type |
15691386 | HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type |
14767062 | HIV-1 Tat K29A, K50R, and K51R lysine mutations downregulate the proportion of soluble tubulin in cells, while the majority of other lysine mutations upregulate the percentage of soluble tubulin compared with the wild-type |
MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLE 1 - 70 PRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHS 71 - 140 IAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPYQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTAL 141 - 210 NRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQ 211 - 280 SVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIP 281 - 350 WGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFESSCQQFDKLRKRDAFLEQFRKEDMFKDNFDE 351 - 420 MDRSREVVQELIDEYHAATQPDYISWGTQEQ 421 - 451 //
PMID | Year | Title |
---|---|---|
27015882 | 2016 | Human TUBG2 gene is expressed as two splice variant mRNA and involved in cell growth. |
22806905 | 2012 | Overexpression of ?-tubulin in non-small cell lung cancer. |
22235350 | 2012 | ?-Tubulin 2 nucleates microtubules and is downregulated in mouse early embryogenesis. |
21525035 | 2011 | PEX14 is required for microtubule-based peroxisome motility in human cells. |
20508983 | 2011 | Centrosome-related genes, genetic variation, and risk of breast cancer. |
16625196 | 2006 | DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. |
15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). |
14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. |
12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. |
12221128 | 2002 | Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex. |
More... |