Property Summary

NCBI Gene PubMed Count 17
PubMed Score 3.37
PubTator Score 2.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.800 6.5e-05
Astrocytoma, Pilocytic -1.300 1.0e-06
atypical teratoid / rhabdoid tumor -2.000 1.0e-08
ependymoma -1.800 6.2e-12
glioblastoma -1.800 2.3e-08
group 3 medulloblastoma -2.000 7.8e-05
interstitial cystitis -1.200 1.0e-03
medulloblastoma, large-cell -3.200 1.3e-06
osteosarcoma -1.173 2.4e-03
Pick disease -1.500 5.6e-06
primitive neuroectodermal tumor -1.400 1.5e-04
subependymal giant cell astrocytoma -1.429 1.4e-02

 MGI Phenotype (1)

Gene RIF (9)

AA Sequence

MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHYIPRAVLLDLE      1 - 70
PRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFDIIDREADGSDSLEGFVLCHS     71 - 140
IAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPYQDEMSDVVVQPYNSLLTLKRLTQNADCVVVLDNTAL    141 - 210
NRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQ    211 - 280
SVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIP    281 - 350
WGPASIQVALSRKSPYLPSAHRVSGLMMANHTSISSLFESSCQQFDKLRKRDAFLEQFRKEDMFKDNFDE    351 - 420
MDRSREVVQELIDEYHAATQPDYISWGTQEQ                                           421 - 451
//

Text Mined References (18)

PMID Year Title