Property Summary

NCBI Gene PubMed Count 16
PubMed Score 42.71
PubTator Score 8.32

Knowledge Summary

Patent (2,087)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 5.2792205669664E-18
psoriasis 6685 2.44554787877365E-12
juvenile dermatomyositis 1189 9.07087475645812E-11
ovarian cancer 8492 4.7239582449199E-8
lung adenocarcinoma 2714 8.46290863811307E-8
atypical teratoid / rhabdoid tumor 4369 2.62938235069742E-5
Pick disease 1893 2.91106690272071E-5
lung cancer 4473 5.03307365426618E-4
interstitial cystitis 2299 9.50027969847087E-4
dermatomyositis 967 0.00137920987626947
osteosarcoma 7933 0.00210607520876751
medulloblastoma, large-cell 6234 0.00230311372254446
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00337134442986788
colon cancer 1475 0.00439090411232433
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00942271200092577
Multiple myeloma 1328 0.0191666544645717
subependymal giant cell astrocytoma 2287 0.0289159012645845
aldosterone-producing adenoma 664 0.0289715623373873
Waldenstrons macroglobulinemia 765 0.0407810064664125

Expression

Synonym

Accession Q9NRH2 B2RAV6 Q14706 Q68D15 Q6IQ46 Q9NXI7
Symbols HSNFRK

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Pathway (1)

Gene RIF (3)

PMID Text
22874833 SNRK inhibits colon cancer cell proliferation through calcyclin-binding protein up-regulation and beta-catenin degradation, which results in reduced proliferation signaling.
22874833 These findings reveal a novel function for SNRK in the regulation of colon cancer cell proliferation and beta-catenin signaling.
15733851 SNRK could mediate some of the physiological effects of LKB1

AA Sequence

MAGFKRGYDGKIAGLYDLDKTLGRGHFAVVKLARHVFTGEKVAVKVIDKTKLDTLATGHLFQEVRCMKLV      1 - 70
QHPNIVRLYEVIDTQTKLYLILELGDGGDMFDYIMKHEEGLNEDLAKKYFAQIVHAISYCHKLHVVHRDL     71 - 140
KPENVVFFEKQGLVKLTDFGFSNKFQPGKKLTTSCGSLAYSAPEILLGDEYDAPAVDIWSLGVILFMLVC    141 - 210
GQPPFQEANDSETLTMIMDCKYTVPSHVSKECKDLITRMLQRDPKRRASLEEIENHPWLQGVDPSPATKY    211 - 280
NIPLVSYKNLSEEEHNSIIQRMVLGDIADRDAIVEALETNRYNHITATYFLLAERILREKQEKEIQTRSA    281 - 350
SPSNIKAQFRQSWPTKIDVPQDLEDDLTATPLSHATVPQSPARAADSVLNGHRSKGLCDSAKKDDLPELA    351 - 420
GPALSTVPPASLKPTASGRKCLFRVEEDEEEDEEDKKPMSLSTQVVLRRKPSVTNRLTSRKSAPVLNQIF    421 - 490
EEGESDDEFDMDENLPPKLSRLKMNIASPGTVHKRYHRRKSQGRGSSCSSSETSDDDSESRRRLDKDSGF    491 - 560
TYSWHRRDSSEGPPGSEGDGGGQSKPSNASGGVDKASPSENNAGGGSPSSGSGGNPTNTSGTTRRCAGPS    561 - 630
NSMQLASRSAGELVESLKLMSLCLGSQLHGSTKYIIDPQNGLSFSSVKVQEKSTWKMCISSTGNAGQVPA    631 - 700
VGGIKFFSDHMADTTTELERIKSKNLKNNVLQLPLCEKTISVNIQRNPKEGLLCASSPASCCHVI         701 - 765
//

Text Mined References (21)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22874833 2012 Snf1-related kinase inhibits colon cancer cell proliferation through calcyclin-binding protein-dependent reduction of ?-catenin.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15733851 2005 Identification of the sucrose non-fermenting related kinase SNRK, as a novel LKB1 substrate.
More...