Property Summary

NCBI Gene PubMed Count 19
PubMed Score 51.36
PubTator Score 8.32

Knowledge Summary

Patent (2,087)

Expression

  Differential Expression (19)

Disease log2 FC p
aldosterone-producing adenoma -1.049 2.9e-02
atypical teratoid / rhabdoid tumor -1.300 2.6e-05
autosomal dominant Emery-Dreifuss muscul... 1.031 9.4e-03
colon cancer -1.700 4.4e-03
dermatomyositis 1.300 1.4e-03
interstitial cystitis 1.200 4.6e-03
intraductal papillary-mucinous carcinoma... -1.100 3.4e-03
juvenile dermatomyositis 1.272 9.1e-11
lung adenocarcinoma -1.100 1.3e-17
lung cancer -1.700 5.0e-04
medulloblastoma, large-cell -1.300 2.3e-03
Multiple myeloma 1.585 1.9e-02
non-small cell lung cancer -1.215 5.3e-18
osteosarcoma -1.115 1.6e-02
ovarian cancer -1.900 4.7e-08
Pick disease 1.100 2.9e-05
psoriasis -1.100 4.3e-03
subependymal giant cell astrocytoma -1.110 2.9e-02
Waldenstrons macroglobulinemia -1.021 4.1e-02

Gene RIF (6)

AA Sequence

MAGFKRGYDGKIAGLYDLDKTLGRGHFAVVKLARHVFTGEKVAVKVIDKTKLDTLATGHLFQEVRCMKLV      1 - 70
QHPNIVRLYEVIDTQTKLYLILELGDGGDMFDYIMKHEEGLNEDLAKKYFAQIVHAISYCHKLHVVHRDL     71 - 140
KPENVVFFEKQGLVKLTDFGFSNKFQPGKKLTTSCGSLAYSAPEILLGDEYDAPAVDIWSLGVILFMLVC    141 - 210
GQPPFQEANDSETLTMIMDCKYTVPSHVSKECKDLITRMLQRDPKRRASLEEIENHPWLQGVDPSPATKY    211 - 280
NIPLVSYKNLSEEEHNSIIQRMVLGDIADRDAIVEALETNRYNHITATYFLLAERILREKQEKEIQTRSA    281 - 350
SPSNIKAQFRQSWPTKIDVPQDLEDDLTATPLSHATVPQSPARAADSVLNGHRSKGLCDSAKKDDLPELA    351 - 420
GPALSTVPPASLKPTASGRKCLFRVEEDEEEDEEDKKPMSLSTQVVLRRKPSVTNRLTSRKSAPVLNQIF    421 - 490
EEGESDDEFDMDENLPPKLSRLKMNIASPGTVHKRYHRRKSQGRGSSCSSSETSDDDSESRRRLDKDSGF    491 - 560
TYSWHRRDSSEGPPGSEGDGGGQSKPSNASGGVDKASPSENNAGGGSPSSGSGGNPTNTSGTTRRCAGPS    561 - 630
NSMQLASRSAGELVESLKLMSLCLGSQLHGSTKYIIDPQNGLSFSSVKVQEKSTWKMCISSTGNAGQVPA    631 - 700
VGGIKFFSDHMADTTTELERIKSKNLKNNVLQLPLCEKTISVNIQRNPKEGLLCASSPASCCHVI         701 - 765
//

Text Mined References (24)

PMID Year Title