Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.54
PubTator Score 0.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.000
group 3 medulloblastoma 1.500 0.000
acute myeloid leukemia -2.000 0.001

AA Sequence

MSWVQAASLIQGPGDKGDVFDEEADESLLAQREWQSNMQRRVKEGYRDGIDAGKAVTLQQGFNQGYKKGA      1 - 70
EVILNYGRLRGTLSALLSWCHLHNNNSTLINKINNLLDAVGQCEEYVLKHLKSITPPSHVVDLLDSIEDM     71 - 140
DLCHVVPAEKKIDEAKDERLCENNAEFNKNCSKSHSGIDCSYVECCRTQEHAHSENPSPTWILEQTASLV    141 - 210
KQLGLSVDVLQHLKQL                                                          211 - 226
//

Text Mined References (10)

PMID Year Title
26182403 2015 The deca-GX3 proteins Yae1-Lto1 function as adaptors recruiting the ABC protein Rli1 for iron-sulfur cluster insertion.
16341674 2005 Transcriptome analysis of human gastric cancer.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9847074 1998 Toward a complete human genome sequence.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.