Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.82
PubTator Score 2.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.9e-03
Disease Target Count Z-score Confidence
Ovarian serous carcinoma 5 3.651 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.300 2.9e-03

Synonym

Accession Q9NRG7 Q6ZW71 Q9BVQ3
Symbols HCDI
C14orf124

Gene

PANTHER Protein Class (2)

PDB

4B4O  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MGWRRKRVPQRGRKAPPPQLHGNINNLYFPIRWRDRLHWDSPNPAAECQRHEVTLVSRKPGPGRITWDEL      1 - 70
AASGLPSCDAAVNLAGENILNPLRRWNETFQKEVIGSRLETTQLLAKAITKAPQPPKAWVLVTGVAYYQP     71 - 140
SLTAEYDEDSPGGDFDFFSNLVTKWEAAARLPGDSTRQVVVRSGVVLGRGGGAMGHMLLPFRLGLGGPIG    141 - 210
SGHQFFPWIHIGDLAGILTHALEANHVHGVLNGVAPSSATNAEFAQTLGAALGRRAFIPLPSAVVQAVFG    211 - 280
RQRAIMLLEGQKVIPQRTLATGYQYSFPELGAALKEIVA                                   281 - 319
//

Text Mined References (9)

PMID Year Title