Property Summary

Ligand Count 17
NCBI Gene PubMed Count 45
PubMed Score 52.67
PubTator Score 30.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Esophageal Neoplasms 69 0.0 0.0
Disease Target Count P-value
Astrocytoma, Pilocytic 3081 3.3e-05
Pick disease 1894 6.5e-04
astrocytic glioma 2597 1.3e-03
lung cancer 4740 1.5e-03
oligodendroglioma 2850 8.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Pneumothorax 23 3.545 1.8

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.900 1.3e-03
Astrocytoma, Pilocytic -1.300 3.3e-05
lung cancer 1.900 1.5e-03
oligodendroglioma -1.500 8.1e-03
Pick disease -1.500 6.5e-04

Gene RIF (32)

AA Sequence

MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQ      1 - 70
AFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDK     71 - 140
LDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCC    141 - 210
PNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIR    211 - 280
KLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVC    281 - 350
LYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDH    351 - 420
PYISEIKQEIESH                                                             421 - 433
//

Text Mined References (47)

PMID Year Title