Property Summary

NCBI Gene PubMed Count 34
Grant Count 3
Funding $26,986
PubMed Score 48.78
PubTator Score 30.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.900 0.001
oligodendroglioma -1.500 0.008
lung cancer 1.900 0.002
pilocytic astrocytoma -1.300 0.000
Pick disease -1.500 0.001

Synonym

Accession Q9NRG4 B2R9P9 I6L9H7 Q4V765 Q5VSH9 Q96AI4
Symbols KMT3C
HSKM-B
ZMYND14

Gene

PDB

4O6F   3TG5   3RIB   3S7B   3S7D   3S7F   3S7J   3TG4   4WUY   4YND   5ARF   5ARG  

 GWAS Trait (1)

Gene RIF (23)

PMID Text
26826421 Suggest that SMYD2 plays a role in tumor progression and might be a useful prognosticator in HPV-unrelated, nonmultiple head and neck squamous cell carcinomas.
26488939 Results show that high expression levels of SMYD2, SETD3, and NO66 in renal cell tumors. Their low expression levels were significantly associated with shorter disease-specific and disease-free survival.
25925379 SMYD2-mediated methylation negatively regulates PTEN tumor suppressor activity and results in activation of the phosphatidylinositol 3-kinase-AKT pathway.
25825497 in addition to esophageal squamous cell carcinoma, SMYD2 is also amplified and/or overexpressed in breast and liver primary tumors
25533488 Comprehensive motif-based searches and mutational analysis further established four additional substrates of SMYD2.
25321194 SMYD2 has a crucial role in tumor cell proliferation by its overexpression and highlight its usefulness as a prognostic factor and potential therapeutic target in gastric cancer.
24880080 A novel mechanism for human carcinogenesis via methylation of HSP90AB1 by SMYD2.
24726141 a novel mechanism of PARP1 in human cancer through its methylation by SMYD2
24631370 SMYD2 expression is altered in acute lymphoblastic leukemia bone marrow samples and its high expression was correlated with a bad prognosis. Moreover, SMYD2 expression level significantly decreases in patients that respond to chemotherapy treatment.
24594358 Data indicate that irect estrogen receptor alpha (ERalpha) methylation by histone methyltransferase SMYD2 regulates estrogen signaling.
More...

AA Sequence

MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQ      1 - 70
AFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDK     71 - 140
LDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCC    141 - 210
PNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIR    211 - 280
KLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVC    281 - 350
LYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDH    351 - 420
PYISEIKQEIESH                                                             421 - 433
//

Text Mined References (37)

PMID Year Title
26826421 2016 SMYD2 overexpression is associated with tumor cell proliferation and a worse outcome in human papillomavirus-unrelated nonmultiple head and neck carcinomas.
26488939 2015 Expression of histone methyltransferases as novel biomarkers for renal cell tumor diagnosis and prognostication.
25925379 2015 Dysregulation of AKT Pathway by SMYD2-Mediated Lysine Methylation on PTEN.
25825497 2015 LLY-507, a Cell-active, Potent, and Selective Inhibitor of Protein-lysine Methyltransferase SMYD2.
25533488 2015 Discovery of substrates for a SET domain lysine methyltransferase predicted by multistate computational protein design.
25321194 2015 Overexpression of SMYD2 contributes to malignant outcome in gastric cancer.
24880080 2014 SMYD2-dependent HSP90 methylation promotes cancer cell proliferation by regulating the chaperone complex formation.
24726141 2014 The histone methyltransferase SMYD2 methylates PARP1 and promotes poly(ADP-ribosyl)ation activity in cancer cells.
24631370 2014 SMYD2 is highly expressed in pediatric acute lymphoblastic leukemia and constitutes a bad prognostic factor.
24594358 2014 Structural insights into estrogen receptor ? methylation by histone methyltransferase SMYD2, a cellular event implicated in estrogen signaling regulation.
More...