Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.26
PubTator Score 4.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute myeloid leukemia -2.200 4.4e-02
Astrocytoma, Pilocytic 1.200 4.5e-05
Breast cancer -1.400 1.9e-03
ependymoma 1.200 4.4e-07
gastric cancer 1.200 1.0e-02
invasive ductal carcinoma -1.084 1.0e-02
lung carcinoma 1.900 2.1e-27
non-small cell lung cancer 1.013 8.1e-10
oligodendroglioma 1.100 1.8e-11
pancreatic cancer 1.500 3.2e-03
pancreatic carcinoma 1.500 3.2e-03

Gene RIF (4)

AA Sequence

MAGSSEEAPDYGRGVVIMDDWPGYDLNLFTYPQHYYGDLEYVLIPHGIIVDRIERLAKDIMKDIGYSDIM      1 - 70
VLCVLKGGYKFCADLVEHLKNISRNSDRFVSMKVDFIRLKSYRNDQSMGEMQIIGGDDLSTLAGKNVLIV     71 - 140
EDVVGTGRTMKALLSNIEKYKPNMIKVASLLVKRTSRSDGFRPDYAGFEIPNLFVVGYALDYNEYFRDLN    141 - 210
HICVINEHGKEKYRV                                                           211 - 225
//

Text Mined References (20)

PMID Year Title