Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.02
PubTator Score 2.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 5.3e-07
atypical teratoid / rhabdoid tumor 1.300 2.1e-07
ependymoma 1.300 4.0e-12
glioblastoma 1.100 8.2e-08
group 3 medulloblastoma 1.500 1.7e-04
medulloblastoma, large-cell 1.300 1.3e-04
ovarian cancer 1.500 1.1e-05
pediatric high grade glioma 1.100 6.1e-06
primitive neuroectodermal tumor 1.100 7.3e-05

 GO Process (1)

Gene RIF (1)

AA Sequence

MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKK      1 - 70
VLTYSDLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS              71 - 131
//

Text Mined References (18)

PMID Year Title