Property Summary

NCBI Gene PubMed Count 16
Grant Count 1
Funding $51,371
PubMed Score 5.86
PubTator Score 35.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.055 0.030
Multiple myeloma 1.982 0.001
malignant mesothelioma 1.200 0.000
psoriasis 1.300 0.000
group 3 medulloblastoma 1.100 0.034
ovarian cancer 2.000 0.000

Synonym

Accession Q9NRF9 Q5W0U1 Q8N758 Q8NCE5 Q9NR32
Symbols p17
YBL1
CHRAC17
CHARAC17

Gene

 Grant Application (1)

Gene RIF (1)

PMID Text
22190034 HIV-1 PR is identified to have a physical interaction with polymerase (DNA directed), epsilon 3 (POLE3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVL      1 - 70
SAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQN     71 - 140
EEEEVDN                                                                   141 - 147
//

Text Mined References (21)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22190034 2011 Global landscape of HIV-human protein complexes.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18838386 2008 Human ATAC Is a GCN5/PCAF-containing acetylase complex with a novel NC2-like histone fold module that interacts with the TATA-binding protein.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
More...