Property Summary

NCBI Gene PubMed Count 12
PubMed Score 13.64
PubTator Score 6.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession Q9NRF8 B3KWM2 Q9BRI0 Q9H809 Q9H8K9
Symbols

Gene

PANTHER Protein Class (1)

PDB

2V4U   2VKT   3IHL  

Gene RIF (3)

PMID Text
21378502 Low CTPS2 expression may be a rationally-based determinant of 5FU resistance.
21252287 CTPS2 was identified by genome-wide gene expression analyses as correlated with cellular sensitivity to cisplatin and carboplatin.
20739275 analysis of the kinetic properties of hCTPS1 and hCTPS2, and determination that Ser(68) is a major site of CTPS2 regulation by phosphorylation

AA Sequence

MKYILVTGGVISGIGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLD      1 - 70
LGNYERFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDAVQEWVMNQAKVPVDGNKEEP     71 - 140
QICVIELGGTIGDIEGMPFVEAFRQFQFKAKRENFCNIHVSLVPQLSATGEQKTKPTQNSVRALRGLGLS    141 - 210
PDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSTYRVPVLLEEQSIVKYFKERLHLPIGDSASN    211 - 280
LLFKWRNMADRYERLQKICSIALVGKYTKLRDCYASVFKALEHSALAINHKLNLMYIDSIDLEKITETED    281 - 350
PVKFHEAWQKLCKADGILVPGGFGIRGTLGKLQAISWARTKKIPFLGVCLGMQLAVIEFARNCLNLKDAD    351 - 420
STEFRPNAPVPLVIDMPEHNPGNLGGTMRLGIRRTVFKTENSILRKLYGDVPFIEERHRHRFEVNPNLIK    421 - 490
QFEQNDLSFVGQDVDGDRMEIIELANHPYFVGVQFHPEFSSRPMKPSPPYLGLLLAATGNLNAYLQQGCK    491 - 560
LSSSDRYSDASDDSFSEPRIAELEIS                                                561 - 586
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21378502 2011 Low cytosine triphosphate synthase 2 expression renders resistance to 5-fluorouracil in colorectal cancer.
21269460 2011 Initial characterization of the human central proteome.
21252287 2011 Comprehensive evaluation of the contribution of X chromosome genes to platinum sensitivity.
20739275 2010 Regulation of human cytidine triphosphate synthetase 2 by phosphorylation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...