Property Summary

NCBI Gene PubMed Count 13
PubMed Score 14.42
PubTator Score 6.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma 1.200 3.6e-25
atypical teratoid / rhabdoid tumor 1.600 1.8e-10
breast carcinoma 1.300 7.4e-26
ependymoma 1.100 6.0e-09
glioblastoma 1.400 3.3e-08
group 3 medulloblastoma 1.200 1.4e-04
ileal Crohn's disease -1.078 4.3e-02
intraductal papillary-mucinous adenoma (... 1.300 9.4e-05
lung cancer 1.200 6.4e-04
malignant mesothelioma -5.200 4.5e-10
medulloblastoma, large-cell 1.500 3.4e-05
oligodendroglioma 1.300 6.2e-19
pediatric high grade glioma 1.400 2.1e-07
primitive neuroectodermal tumor 1.200 7.7e-06

 MGI Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (3)

AA Sequence

MKYILVTGGVISGIGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLD      1 - 70
LGNYERFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDAVQEWVMNQAKVPVDGNKEEP     71 - 140
QICVIELGGTIGDIEGMPFVEAFRQFQFKAKRENFCNIHVSLVPQLSATGEQKTKPTQNSVRALRGLGLS    141 - 210
PDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSTYRVPVLLEEQSIVKYFKERLHLPIGDSASN    211 - 280
LLFKWRNMADRYERLQKICSIALVGKYTKLRDCYASVFKALEHSALAINHKLNLMYIDSIDLEKITETED    281 - 350
PVKFHEAWQKLCKADGILVPGGFGIRGTLGKLQAISWARTKKIPFLGVCLGMQLAVIEFARNCLNLKDAD    351 - 420
STEFRPNAPVPLVIDMPEHNPGNLGGTMRLGIRRTVFKTENSILRKLYGDVPFIEERHRHRFEVNPNLIK    421 - 490
QFEQNDLSFVGQDVDGDRMEIIELANHPYFVGVQFHPEFSSRPMKPSPPYLGLLLAATGNLNAYLQQGCK    491 - 560
LSSSDRYSDASDDSFSEPRIAELEIS                                                561 - 586
//

Text Mined References (19)

PMID Year Title