Property Summary

NCBI Gene PubMed Count 62
Grant Count 53
R01 Count 30
Funding $2,563,220.69
PubMed Score 59.81
PubTator Score 59.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.700 0.000
osteosarcoma 1.049 0.001

Gene RIF (46)

PMID Text
26077624 that SH2B1 is a key positive mediator of pathological cardiac hypertrophy
26031769 Mutation analysis has demonstrated that variation in the SH2B1 gene is frequent in both lean and obese groups, with distinctive variations being present on either side of the weight spectrum.
25471250 The rs7359397 (SH2B1) was associated with the body weight, body mass index, and truncal fat mass reduction.
25234362 We report evidence that the 16p11.2 deletion may influence specific obesity-associated disinhibited eating behaviors
24971614 4 novel variants in SH2B1 were identified in individuals with obesity and insulin resistance.
24736401 SH2B1 can enhance neurite outgrowth and accelerate the maturation of human induced neurons under defined conditions.
24621099 This study highlighted the importance of two candidate genes, SH2B1 and FAIM2, in the risk of overweight/obesity.
24103803 Data (from in excess of six genetic association studies) suggest that an SNP in SH2B1 (rs4788102) is not associated with abnormal glucose homeostasis in obese subjects of European ancestry. [META-ANALYSIS]
23825611 rare missense mutations of FTO and SH2B1 did not confer risks of obesity in Chinese Han children in our cohort
23640704 Common variants near BDNF and SH2B1 show nominal evidence of association with snacking behavior in European populations.
More...

AA Sequence

MNGAPSPEDGASPSSPPLPPPPPPSWREFCESHARAAALDFARRFRLYLASHPQYAGPGAEAAFSRRFAE      1 - 70
LFLQHFEAEVARASGSLSPPILAPLSPGAEISPHDLSLESCRVGGPLAVLGPSRSSEDLAGPLPSSVSSS     71 - 140
STTSSKPKLKKRFSLRSVGRSVRGSVRGILQWRGTVDPPSSAGPLETSSGPPVLGGNSNSNSSGGAGTVG    141 - 210
RGLVSDGTSPGERWTHRFERLRLSRGGGALKDGAGMVQREELLSFMGAEEAAPDPAGVGRGGGVAGPPSG    211 - 280
GGGQPQWQKCRLLLRSEGEGGGGSRLEFFVPPKASRPRLSIPCSSITDVRTTTALEMPDRENTFVVKVEG    281 - 350
PSEYIMETVDAQHVKAWVSDIQECLSPGPCPATSPRPMTLPLAPGTSFLTRENTDSLELSCLNHSESLPS    351 - 420
QDLLLGPSESNDRLSQGAYGGLSDRPSASISPSSASIAASHFDSMELLPPELPPRIPIEEGPPTGTVHPL    421 - 490
SAPYPPLDTPETATGSFLFQGEPEGGEGDQPLSGYPWFHGMLSRLKAAQLVLTGGTGSHGVFLVRQSETR    491 - 560
RGEYVLTFNFQGKAKHLRLSLNEEGQCRVQHLWFQSIFDMLEHFRVHPIPLESGGSSDVVLVSYVPSSQR    561 - 630
QQEPTTSHDPPQPPEPPSWTDPPQPGAEEASRAPEVAAAAAAAAKERQEKEKAGGGGVPEELVPVVELVP    631 - 700
VVELEEAIAPGSEAQGAGSGGDAGVPPMVQLQQSPLGGDGEEGGHPRAINNQYSFV                  701 - 756
//

Text Mined References (76)

PMID Year Title
26077624 2015 SH2B1 is critical for the regulation of cardiac remodelling in response to pressure overload.
26031769 2015 Genetic and structural variation in the SH2B1 gene in the Belgian population.
25471250 2015 SH2B1 CpG-SNP is associated with body weight reduction in obese subjects following a dietary restriction program.
25234362 2014 Eating in the absence of hunger but not loss of control behaviors are associated with 16p11.2 deletions.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24971614 2014 Functional characterization of obesity-associated variants involving the ? and ? isoforms of human SH2B1.
24736401 2014 Signaling adaptor protein SH2B1 enhances neurite outgrowth and accelerates the maturation of human induced neurons.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24621099 2014 Meta-analyses between 18 candidate genetic markers and overweight/obesity.
24396070 2014 SH2B1? interacts with STAT3 and enhances fibroblast growth factor 1-induced gene expression during neuronal differentiation.
More...