Property Summary

Ligand Count 8
NCBI Gene PubMed Count 51
PubMed Score 53.33
PubTator Score 66.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Abortion, Spontaneous 109 0.0 0.0
Skin Diseases 71 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Hemolytic anemia 77 0.0 3.0
Malaria 160 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 3.11 1.6

Gene RIF (41)

AA Sequence

MQLVILRVTIFLPWCFAVPVPPAADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQFHRNGTDLLD      1 - 70
MQMHALLHQPHCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQ     71 - 140
QVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEI    141 - 210
GHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP                       211 - 261
//

Text Mined References (51)

PMID Year Title