Property Summary

NCBI Gene PubMed Count 52
PubMed Score 51.91
PubTator Score 66.72

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (41)

PMID Text
26279442 MMP26+CXCR4+ cells may be circulating tumor cells in hepatocellular carcinoma.
25566961 We found that only inhibition of JNK significantly decreased the activation of MMP26 in response to FGF1 stimulation, suggesting that activation of FGFR1 signaling may activate JNK to activate MMP26 in non-small-cell lung cancer
25262277 Overexpression of MMP26 in SW1353 cells increased cell invasiveness, while inhibition of MMP26 decreased cell invasiveness.
25093616 The binding of MMP-26 to GDF15 was responsible for the processing and maturation of pro-GDF15, and the process was dependent on enzymatic activity of MMP-26. In human placental trophoblast cells, MMP-26 could facilitate the pro-apoptotic effect of GDF15.
25091573 High MMP26 expression is associated with metastasis of hepatocellular carcinoma.
24565841 These results demonstrate that the HOXA10-mediated expression of MMP-26 promotes embryo adhesion during the process of embryonic implantation.
24318970 matrilysin-2 was an independent prognostic marker for patients with colorectal cancer
23754174 The MMP-26 promoter region contains a putative ER response element.
23634280 expression of MMP-26 protein was predominantly located in pre- and early-invasive areas suggesting MMP-26 expression as an early event in promoting GM-CSF dependent tumor invasion.
21945733 Molecular analyses showed significant downregulation of expression of MMP-26 (p=0.03), and significant 9.8-fold upregulation of TGF-beta (p=0.01) in more degenerated discs vs. healthier discs.
More...

AA Sequence

MQLVILRVTIFLPWCFAVPVPPAADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQFHRNGTDLLD      1 - 70
MQMHALLHQPHCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQ     71 - 140
QVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEI    141 - 210
GHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP                       211 - 261
//

Text Mined References (52)

PMID Year Title
27143441 2016 MiR-125b regulates endometrial receptivity by targeting MMP26 in women undergoing IVF-ET with elevated progesterone on HCG priming day.
26279442 2015 Circulating Hepatocellular Carcinoma Cells are Characterized by CXCR4 and MMP26.
25566961 2015 Activation of FGF receptor signaling promotes invasion of non-small-cell lung cancer.
25262277 2015 Regulation of chondrosarcoma invasion by MMP26.
25093616 2014 Maturation of growth differentiation factor 15 in human placental trophoblast cells depends on the interaction with Matrix Metalloproteinase-26.
25091573 2014 Inhibition of fibroblast growth factor receptor signaling impairs metastasis of hepatocellular carcinoma.
24565841 2014 Activation of matrix metalloproteinase-26 by HOXA10 promotes embryo adhesion in vitro.
24318970 2014 Matrilysin-2 expression in colorectal cancer is associated with overall survival of patients.
23754174 2013 Estrogen and estrogen receptor induce matrix metalloproteinase-26 expression in endometrial carcinoma cells.
23634280 2013 GM-CSF enhances tumor invasion by elevated MMP-2, -9, and -26 expression.
More...