Property Summary

NCBI Gene PubMed Count 54
Grant Count 86
R01 Count 65
Funding $9,156,112.57
PubMed Score 255.69
PubTator Score 52.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
esophageal adenocarcinoma -2.700 0.029
Atopic dermatitis 1.500 0.000
adrenocortical carcinoma -1.742 0.000
non-small cell lung cancer -2.531 0.000
lung cancer -4.300 0.000
sarcoidosis -1.600 0.026
interstitial cystitis -3.000 0.000
lung adenocarcinoma -3.000 0.000
primary Sjogren syndrome -1.100 0.003
nasopharyngeal carcinoma -2.100 0.000
psoriasis 1.400 0.000
Endometriosis -1.915 0.050
lung carcinoma -3.200 0.000
gastric carcinoma -2.000 0.044

Synonym

Accession Q9NRD9 A6NH28 Q14C94 Q6ZMB3 Q6ZR09 Q9NZC1
Symbols LNOX1
THOX1
NOXEF1

Gene

PANTHER Protein Class (2)

Gene RIF (39)

PMID Text
25848056 These data reveal a key role of DUOX1-dependent hydrogen peroxide production in long-term persistent radio-induced DNA damage.
25586178 Duox2 proteins possessing the A-loops of Nox1 or Nox5 co-expressed with DuoxA2 showed enhanced O2 () release, and Duox1 proteins possessing the A-loops of Nox1 or Nox5 co-expressed with DuoxA1 acquired O2 () leakage
25164816 Duox1 activity is stimulated by testosterone through GPRC6A in skin keratinocytes
24624333 Studies demonstrate the importance of DUOX1 in epithelial redox signaling through reversible S-glutathionylation of a range of proteins, including proteins involved in cytoskeletal regulation and MAPK signaling pathways involved in cell migration.
24332816 DUOX1 is the major H2O2-producing source in NHKs stimulated with Ca(2+), and plays a significant role in regulating the expression of specific markers necessary for the normal differentiation of keratinocytes
24164541 Underscore the importance of DUOX1 and DUOX2 in vesicant-induced IL-6 secretion in human airway epithelial cells.
24161126 Despite the high sequence similarity shared between DUOX1 and DUOX2, the two isoforms present distinct regulations, tissue expression and catalytic functions
24128054 Further, ROS generated by Duox enzymes localized adjacent to nuclear speckles altered the splicing of viral genes
23691121 PA-LPS-induced MUC5AC and Clca3 expression is partly through Duox1
23362256 Study indicates a complex profile of protein interactions required for activity and localization of the DUOX1 and DOOX2 enzymes.
More...

AA Sequence

MGFCLALAWTLLVGAWTPLGAQNPISWEVQRFDGWYNNLMEHRWGSKGSRLQRLVPASYADGVYQPLGEP      1 - 70
HLPNPRDLSNTISRGPAGLASLRNRTVLGVFFGYHVLSDLVSVETPGCPAEFLNIRIPPGDPMFDPDQRG     71 - 140
DVVLPFQRSRWDPETGRSPSNPRDPANQVTGWLDGSAIYGSSHSWSDALRSFSRGQLASGPDPAFPRDSQ    141 - 210
NPLLMWAAPDPATGQNGPRGLYAFGAERGNREPFLQALGLLWFRYHNLWAQRLARQHPDWEDEELFQHAR    211 - 280
KRVIATYQNIAVYEWLPSFLQKTLPEYTGYRPFLDPSISSEFVAASEQFLSTMVPPGVYMRNASCHFQGV    281 - 350
INRNSSVSRALRVCNSYWSREHPSLQSAEDVDALLLGMASQIAEREDHVLVEDVRDFWPGPLKFSRTDHL    351 - 420
ASCLQRGRDLGLPSYTKARAALGLSPITRWQDINPALSRSNDTVLEATAALYNQDLSWLELLPGGLLESH    421 - 490
RDPGPLFSTIVLEQFVRLRDGDRYWFENTRNGLFSKKEIEEIRNTTLQDVLVAVINIDPSALQPNVFVWH    491 - 560
KGDPCPQPRQLSTEGLPACAPSVVRDYFEGSGFGFGVTIGTLCCFPLVSLLSAWIVARLRMRNFKRLQGQ    561 - 630
DRQSIVSEKLVGGMEALEWQGHKEPCRPVLVYLQPGQIRVVDGRLTVLRTIQLQPPQKVNFVLSSNRGRR    631 - 700
TLLLKIPKEYDLVLLFNLEEERQALVENLRGALKESGLSIQEWELREQELMRAAVTREQRRHLLETFFRH    701 - 770
LFSQVLDINQADAGTLPLDSSQKVREALTCELSRAEFAESLGLKPQDMFVESMFSLADKDGNGYLSFREF    771 - 840
LDILVVFMKGSPEEKSRLMFRMYDFDGNGLISKDEFIRMLRSFIEISNNCLSKAQLAEVVESMFRESGFQ    841 - 910
DKEELTWEDFHFMLRDHNSELRFTQLCVKGVEVPEVIKDLCRRASYISQDMICPSPRVSARCSRSDIETE    911 - 980
LTPQRLQCPMDTDPPQEIRRRFGKKVTSFQPLLFTEAHREKFQRSCLHQTVQQFKRFIENYRRHIGCVAV    981 - 1050
FYAIAGGLFLERAYYYAFAAHHTGITDTTRVGIILSRGTAASISFMFSYILLTMCRNLITFLRETFLNRY   1051 - 1120
VPFDAAVDFHRLIASTAIVLTVLHSVGHVVNVYLFSISPLSVLSCLFPGLFHDDGSELPQKYYWWFFQTV   1121 - 1190
PGLTGVVLLLILAIMYVFASHHFRRRSFRGFWLTHHLYILLYVLLIIHGSFALIQLPRFHIFFLVPAIIY   1191 - 1260
GGDKLVSLSRKKVEISVVKAELLPSGVTHLRFQRPQGFEYKSGQWVRIACLALGTTEYHPFTLTSAPHED   1261 - 1330
TLSLHIRAAGPWTTRLREIYSAPTGDRCARYPKLYLDGPFGEGHQEWHKFEVSVLVGGGIGVTPFASILK   1331 - 1400
DLVFKSSVSCQVFCKKIYFIWVTRTQRQFEWLADIIREVEENDHQDLVSVHIYITQLAEKFDLRTTMLYI   1401 - 1470
CERHFQKVLNRSLFTGLRSITHFGRPPFEPFFNSLQEVHPQVRKIGVFSCGPPGMTKNVEKACQLINRQD   1471 - 1540
RTHFSHHYENF                                                              1541 - 1551
//

Text Mined References (55)

PMID Year Title
25848056 2015 NADPH oxidase DUOX1 promotes long-term persistence of oxidative stress after an exposure to irradiation.
25586178 2015 The extracellular A-loop of dual oxidases affects the specificity of reactive oxygen species release.
25164816 2014 Testosterone stimulates Duox1 activity through GPRC6A in skin keratinocytes.
24624333 2014 Identification of DUOX1-dependent redox signaling through protein S-glutathionylation in airway epithelial cells.
24332816 2014 Hydrogen peroxide generated by DUOX1 regulates the expression levels of specific differentiation markers in normal human keratinocytes.
24164541 2014 Role of nicotinamide adenine dinucleotide phosphate oxidase in mediating vesicant-induced interleukin-6 secretion in human airway epithelial cells.
24161126 2014 Roles of DUOX-mediated hydrogen peroxide in metabolism, host defense, and signaling.
24128054 2014 Mucosal reactive oxygen species are required for antiviral response: role of Duox in influenza a virus infection.
23691121 2013 P. aeruginosa lipopolysaccharide-induced MUC5AC and CLCA3 expression is partly through Duox1 in vitro and in vivo.
23362256 2013 Conserved cysteine residues provide a protein-protein interaction surface in dual oxidase (DUOX) proteins.
More...