Property Summary

NCBI Gene PubMed Count 83
Grant Count 54
R01 Count 29
Funding $4,697,093.54
PubMed Score 226.99
PubTator Score 153.89

Knowledge Summary

Patent

No data available

Expression

Gene RIF (68)

PMID Text
27349010 inactivating mutations in the DUOXA2 (p.Y246X) and DUOX2 (p.R885Q) genes were identified in a set of dizygotic twins with congenital hypothyroidism
26823467 Decreased Panx1 function is a response to cell acidification mediated by IFN-gamma-induced up-regulation of Duox2.
26742565 The prognosis of Japanese patients with DUOX2 defects was usually transient Congenital hypothyroidism. Delayed improvement of thyroglobulin indicates that these patients have subclinical hypothyroidism.
26506010 Results identified 2 mutations in DUOX2 gene from patient with congenital hypothyroidism and report new cryptic splicing sites in the intron 17 and exon 18.
26349762 Prevalence of DUOX2 pathogenic variants is 29% among patients with congenital hypothyroidism in Guangxi, China. Monoallelic and biallelic DUOX2 variants are associated with transient, while triallelic variants are associated with permanent disease.
26261005 Mucosal dysbiosis leads to increased expression of DUOX2, which might be a marker of perturbed mucosal homeostasis in patients with early-stage inflammatory bowel disease.
26207686 Taken together these data suggest that chemopotentiation by LDFRT in gastric cancer cells may be due, at least in part, to increased ROS production (DUOX2) without upregulation of the DNA repair machinery
26056003 findings demonstrate that PKCalpha plays a critical role in HCC development by inducing DUOX2 expression and ROS generation, and propose a strategy to target PKCalpha/DUOX2 as a potential adjuvant therapy for HCC treatment
26046128 DUOX2 played an important role in innate immunity against Klebsiella pneumoniae cytoinvasion through the reactive oxygen species pathway in T24 cells.
25761904 The folding of DUOX2 appears to be a key event in the trafficking of the DUOX2/DUOXA2 complex as it promotes an appropriate conformation of the N-terminal region, which is propitious to subsequent covalent interactions with the maturation factor, DUOXA2.
More...

AA Sequence

MLRARPEALMLLGALLTGSLGPSGNQDALSLPWEVQRYDGWFNNLRHHERGAVGCRLQRRVPANYADGVY      1 - 70
QALEEPQLPNPRRLSNAATRGIAGLPSLHNRTVLGVFFGYHVLSDVVSVETPGCPAEFLNIRIPPGDPVF     71 - 140
DPDQRGDVVLPFQRSRWDPETGRSPSNPRDLANQVTGWLDGSAIYGSSHSWSDALRSFSGGQLASGPDPA    141 - 210
FPRDSQNPLLMWAAPDPATGQNGPRGLYAFGAERGNREPFLQALGLLWFRYHNLWAQRLARQHPDWEDEE    211 - 280
LFQHARKRVIATYQNIAVYEWLPSFLQKTLPEYTGYRPFLDPSISPEFVVASEQFFSTMVPPGVYMRNAS    281 - 350
CHFRKVLNKGFQSSQALRVCNNYWIRENPNLNSTQEVNELLLGMASQISELEDNIVVEDLRDYWPGPGKF    351 - 420
SRTDYVASSIQRGRDMGLPSYSQALLAFGLDIPRNWSDLNPNVDPQVLEATAALYNQDLSQLELLLGGLL    421 - 490
ESHGDPGPLFSAIVLDQFVRLRDGDRYWFENTRNGLFSKKEIEDIRNTTLRDVLVAVINIDPSALQPNVF    491 - 560
VWHKGAPCPQPKQLTTDGLPQCAPLTVLDFFEGSSPGFAITIIALCCLPLVSLLLSGVVAYFRGREHKKL    561 - 630
QKKLKESVKKEAAKDGVPAMEWPGPKERSSPIIIQLLSDRCLQVLNRHLTVLRVVQLQPLQQVNLILSNN    631 - 700
RGCRTLLLKIPKEYDLVLLFSSEEERGAFVQQLWDFCVRWALGLHVAEMSEKELFRKAVTKQQRERILEI    701 - 770
FFRHLFAQVLDINQADAGTLPLDSSQKVREALTCELSRAEFAESLGLKPQDMFVESMFSLADKDGNGYLS    771 - 840
FREFLDILVVFMKGSPEDKSRLMFTMYDLDENGFLSKDEFFTMMRSFIEISNNCLSKAQLAEVVESMFRE    841 - 910
SGFQDKEELTWEDFHFMLRDHDSELRFTQLCVKGGGGGGNGIRDIFKQNISCRVSFITRTPGERSHPQGL    911 - 980
GPPAPEAPELGGPGLKKRFGKKAAVPTPRLYTEALQEKMQRGFLAQKLQQYKRFVENYRRHIVCVAIFSA    981 - 1050
ICVGVFADRAYYYGFASPPSDIAQTTLVGIILSRGTAASVSFMFSYILLTMCRNLITFLRETFLNRYVPF   1051 - 1120
DAAVDFHRWIAMAAVVLAILHSAGHAVNVYIFSVSPLSLLACIFPNVFVNDGSKLPQKFYWWFFQTVPGM   1121 - 1190
TGVLLLLVLAIMYVFASHHFRRRSFRGFWLTHHLYILLYALLIIHGSYALIQLPTFHIYFLVPAIIYGGD   1191 - 1260
KLVSLSRKKVEISVVKAELLPSGVTYLQFQRPQGFEYKSGQWVRIACLALGTTEYHPFTLTSAPHEDTLS   1261 - 1330
LHIRAVGPWTTRLREIYSSPKGNGCAGYPKLYLDGPFGEGHQEWHKFEVSVLVGGGIGVTPFASILKDLV   1331 - 1400
FKSSLGSQMLCKKIYFIWVTRTQRQFEWLADIIQEVEENDHQDLVSVHIYVTQLAEKFDLRTTMLYICER   1401 - 1470
HFQKVLNRSLFTGLRSITHFGRPPFEPFFNSLQEVHPQVRKIGVFSCGPPGMTKNVEKACQLVNRQDRAH   1471 - 1540
FMHHYENF                                                                 1541 - 1548
//

Text Mined References (86)

PMID Year Title
27349010 2016 Heterozygous Mutations of the DUOXA2 and DUOX2 Genes in Dizygotic Twins with Congenital Hypothyroidism.
26823467 2016 Dual Oxidase 2 (Duox2) Regulates Pannexin 1-mediated ATP Release in Primary Human Airway Epithelial Cells via Changes in Intracellular pH and Not H2O2 Production.
26742565 2016 Natural course of congenital hypothyroidism by dual oxidase 2 mutations from the neonatal period through puberty.
26506010 2016 Compound heterozygous DUOX2 gene mutations (c.2335-1G>C/c.3264_3267delCAGC) associated with congenital hypothyroidism. Characterization of complex cryptic splice sites by minigene analysis.
26349762 2015 Mutation screening of DUOX2 in Chinese patients with congenital hypothyroidism.
26301257 2015 Defects in NADPH Oxidase Genes NOX1 and DUOX2 in Very Early Onset Inflammatory Bowel Disease.
26261005 2015 Increased Expression of DUOX2 Is an Epithelial Response to Mucosal Dysbiosis Required for Immune Homeostasis in Mouse Intestine.
26207686 2015 Contribution of Dual Oxidase 2 (DUOX2) to Hyper-Radiosensitivity in Human Gastric Cancer Cells.
26056003 2015 PKC? promotes generation of reactive oxygen species via DUOX2 in hepatocellular carcinoma.
26046128 2015 DUOX2 promotes the elimination of the Klebsiella pneumoniae strain K5 from T24 cells through the reactive oxygen species pathway.
More...