Property Summary

NCBI Gene PubMed Count 61
Grant Count 133
R01 Count 64
Funding $10,170,731.83
PubMed Score 148.63
PubTator Score 2023.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.600 0.000
medulloblastoma, large-cell -1.500 0.000
pediatric high grade glioma -1.300 0.000

Synonym

Accession Q9NRD5 B3KS52 O95906
Symbols PICK
PRKCABP

Gene

PANTHER Protein Class (2)

PDB

2GZV  

Gene RIF (30)

PMID Text
26466675 We propose that PICK1 negatively regulates neoplastic infiltration of astrocytic tumors and that manipulation of PICK1 is an attractive possibility for therapeutic intervention
26073603 Unlike accessory domains in other BAR domain proteins, the positioning of the PDZ domains is flexible, enabling PICK1 to perform long-range, dynamic scaffolding of membrane-associated proteins.
25657323 PICK1 domain ACT links PICK1-associated vesicles to a motility factor, likely myosin, but, contrary to previous reports, PICK1 neither binds nor inhibits Arp2/3 complex.
25023278 Data indicate three principal binding modes can account for protein interacting with C-kinase 1 (PICK1) PDZ domains binding specificity.
24937449 These data indicate that Pick1 is involved in regulating the cell-cell junction in epithelial cells.
24723684 PICK1 promotes Ago2 localization at endosomal compartments in neuronal dendrites and inhibits Ago2 function in translational repression following neuronal stimulation.
24358315 C-terminal domain of ICA69 interacts with PICK1 and acts on trafficking of PICK1-PKCalpha complex and cerebellar plasticity.
22710801 PICK1 increases caveolin-mediated endocytosis, ubiquitination and degradation of TGF-beta type I receptor.
22436349 Family-based association study failed to observe a statistically significant association for any of the genotyped SNPs in the PICK1 gene and attention-deficit hyperactivity disorder.
22303009 Our data suggest a selective role of PICK1 in clustering and reducing the recycling rates of PDZ domain binding partners sorted to the Rab11-dependent recycling pathway.
More...

AA Sequence

MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEI      1 - 70
TGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLS     71 - 140
RAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQPAASEAFVKF    141 - 210
ADAHRSIEKFGIRLLKTIKPMLTDLNTYLNKAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIAL    211 - 280
GEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYA    281 - 350
VLRDADVFPIEVDLAHTTLAYGLNQEEFTDGEEEEEEEDTAAGEPSRDTRGAAGPLDKGGSWCDS         351 - 415
//

Text Mined References (64)

PMID Year Title
26466675 2015 Protein interacting with C kinase 1 suppresses invasion and anchorage-independent growth of astrocytic tumor cells.
26073603 2015 Structure of Dimeric and Tetrameric Complexes of the BAR Domain Protein PICK1 Determined by Small-Angle X-Ray Scattering.
25657323 2015 PICK1 is implicated in organelle motility in an Arp2/3 complex-independent manner.
25023278 2014 Protein interacting with C-kinase 1 (PICK1) binding promiscuity relies on unconventional PSD-95/discs-large/ZO-1 homology (PDZ) binding modes for nonclass II PDZ ligands.
24937449 2014 Pick1 modulates ephrinB1-induced junctional disassembly through an association with ephrinB1.
24723684 2014 PICK1 links Argonaute 2 to endosomes in neuronal dendrites and regulates miRNA activity.
24358315 2013 C-terminal domain of ICA69 interacts with PICK1 and acts on trafficking of PICK1-PKC? complex and cerebellar plasticity.
22710801 2012 PICK1 promotes caveolin-dependent degradation of TGF-? type I receptor.
22436349 2012 Family-based association study of cocaine- and amphetamine-regulated transcript (CARTPT) and protein interaction with C-kinase-1 (PICK1) genes in attention-deficit hyperactivity disorder.
22303009 2012 Protein interacting with C kinase 1 (PICK1) reduces reinsertion rates of interaction partners sorted to Rab11-dependent slow recycling pathway.
More...