Property Summary

NCBI Gene PubMed Count 64
PubMed Score 158.92
PubTator Score 2023.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma -1.200 2.9e-04
atypical teratoid / rhabdoid tumor -1.400 5.2e-08
glioblastoma -1.600 1.1e-06
medulloblastoma, large-cell -1.500 1.8e-06

Gene RIF (33)

AA Sequence

MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEI      1 - 70
TGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLS     71 - 140
RAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQPAASEAFVKF    141 - 210
ADAHRSIEKFGIRLLKTIKPMLTDLNTYLNKAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIAL    211 - 280
GEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYA    281 - 350
VLRDADVFPIEVDLAHTTLAYGLNQEEFTDGEEEEEEEDTAAGEPSRDTRGAAGPLDKGGSWCDS         351 - 415
//

Text Mined References (67)

PMID Year Title