Property Summary

NCBI Gene PubMed Count 16
PubMed Score 13.69
PubTator Score 24.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (11)

Disease log2 FC p
active Crohn's disease 1.446 8.4e-03
active ulcerative colitis 1.414 4.2e-03
Breast cancer 1.400 5.4e-11
breast carcinoma 1.100 1.0e-18
interstitial cystitis 1.200 1.3e-02
invasive ductal carcinoma 1.100 2.3e-02
juvenile dermatomyositis 1.205 2.0e-08
medulloblastoma, large-cell -1.500 2.1e-03
ovarian cancer 1.400 2.9e-04
psoriasis 1.200 1.0e-24
tuberculosis 2.100 5.5e-05

Gene RIF (7)

AA Sequence

MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLREGFITKDWDQ      1 - 70
PVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMC     71 - 140
LKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNN    141 - 210
ATWTEVSYTFSDYPRGVRYILFQHGGRDTQYWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEE    211 - 280
AAQSPYRAVVQIF                                                             281 - 293
//

Text Mined References (20)

PMID Year Title