Property Summary

NCBI Gene PubMed Count 17
PubMed Score 51.20
PubTator Score 22.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 1.3e-08
pancreatic ductal adenocarcinoma liver metastasis 1962 2.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer -2.400 1.3e-08
pancreatic ductal adenocarcinoma liver m... -1.131 2.0e-02

Gene RIF (6)

AA Sequence

MGQGLWRVVRNQQLQQEGYSEQGYLTREQSRRMAASNISNTNHRKQVQGGIDIYHLLKARKSKEQEGFIN      1 - 70
LEMLPPELSFTILSYLNATDLCLASCVWQDLANDELLWQGLCKSTWGHCSIYNKNPPLGFSFRKLYMQLD     71 - 140
EGSLTFNANPDEGVNYFMSKGILDDSPKEIAKFIFCTRTLNWKKLRIYLDERRDVLDDLVTLHNFRNQFL    141 - 210
PNALREFFRHIHAPEERGEYLETLITKFSHRFCACNPDLMRELGLSPDAVYVLCYSLILLSIDLTSPHVK    211 - 280
NKMSKREFIRNTRRAAQNISEDFVGHLYDNIYLIGHVAA                                   281 - 319
//

Text Mined References (19)

PMID Year Title