Property Summary

NCBI Gene PubMed Count 29
PubMed Score 30.58
PubTator Score 60.65

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease 1.070 8.0e-03
adult high grade glioma 1.700 4.1e-04
atypical teratoid / rhabdoid tumor 1.500 2.5e-04
cystic fibrosis -1.226 1.5e-05
glioblastoma 1.500 7.2e-05
medulloblastoma, large-cell 1.900 1.1e-05
non-small cell lung cancer -1.379 3.2e-20
osteosarcoma -1.804 2.8e-05
ovarian cancer 1.600 7.2e-11

Gene RIF (13)

AA Sequence

MAEAATGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYILRVPLKINDNLSTVSMFLNTLTPKFYVALTGTS      1 - 70
SLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSNGDSDSNRQSVSECKVWRNPL     71 - 140
NLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDSDHLRPADAIMQKAWRERNPQARISAAHEAL    141 - 210
EINEIRSRVEVPLIASSTIWEIKLLPKCATAYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHH    211 - 280
GSQYEAQHRRDTNVLVYIKRRLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYAD    281 - 350
VQAVLAKYDDISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYL    351 - 420
LEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIPYPLEKGHLFYPYPICT    421 - 490
ETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELMGVFAKAMIDIFCSAEFRDWN    491 - 560
CKSIFMRVEDELEIPPAPQSQHFQN                                                 561 - 585
//

Text Mined References (34)

PMID Year Title