Property Summary

NCBI Gene PubMed Count 29
Grant Count 2
Funding $143,742
PubMed Score 30.58
PubTator Score 60.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma -1.804 0.000
cystic fibrosis -1.226 0.000
atypical teratoid / rhabdoid tumor 1.500 0.000
glioblastoma 1.500 0.000
medulloblastoma, large-cell 1.900 0.000
non-small cell lung cancer -1.379 0.000
active Crohn's disease 1.070 0.008
adult high grade glioma 1.700 0.000
ovarian cancer 1.900 0.000

Gene RIF (13)

PMID Text
24453002 The tumor suppressor ST7 is a key gene silenced by PRMT5.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20238225 ST7 mediates tumor suppression through the regulation of the genes involved in maintaining the cellular structure of the cell and involved in oncogenic pathways
19913121 Observational study of gene-disease association. (HuGE Navigator)
19736351 Observational study of gene-disease association. (HuGE Navigator)
19058789 Observational study of gene-disease association. (HuGE Navigator)
14669308 ST7 gene may not be the target gene of inactivation at 7q31 site in gastric carcinoma.
14534688 somatic mutations of ST7 do not commonly contribute to the molecular pathogenesis of human malignant myeloid tumors
12545169 These data suggest that LOH at 7q31-q35 is involved in the origin or progression of at least a subset of esophageal carcinomas, but that ST7 is not the target gene of this somatic event.
More...

AA Sequence

MAEAATGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYILRVPLKINDNLSTVSMFLNTLTPKFYVALTGTS      1 - 70
SLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSNGDSDSNRQSVSECKVWRNPL     71 - 140
NLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDSDHLRPADAIMQKAWRERNPQARISAAHEAL    141 - 210
EINEIRSRVEVPLIASSTIWEIKLLPKCATAYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHH    211 - 280
GSQYEAQHRRDTNVLVYIKRRLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYAD    281 - 350
VQAVLAKYDDISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYL    351 - 420
LEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIPYPLEKGHLFYPYPICT    421 - 490
ETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELMGVFAKAMIDIFCSAEFRDWN    491 - 560
CKSIFMRVEDELEIPPAPQSQHFQN                                                 561 - 585
//

Text Mined References (34)

PMID Year Title
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24453002 2014 Genetic validation of the protein arginine methyltransferase PRMT5 as a candidate therapeutic target in glioblastoma.
22872573 2012 Genome-wide association study of prognosis in advanced non-small cell lung cancer patients receiving platinum-based chemotherapy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20238225 2011 Localization and characterization of ST7 in cancer.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19736351 2009 Recurrent rearrangements in synaptic and neurodevelopmental genes and shared biologic pathways in schizophrenia, autism, and mental retardation.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
More...