Property Summary

NCBI Gene PubMed Count 15
PubMed Score 9.48
PubTator Score 5.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
glioblastoma -1.100 2.3e-05
intraductal papillary-mucinous adenoma (... -1.300 9.2e-05
intraductal papillary-mucinous carcinoma... -1.400 3.7e-04
intraductal papillary-mucinous neoplasm ... -1.500 3.0e-04
medulloblastoma, large-cell -1.200 1.4e-03
osteosarcoma 1.136 1.4e-05
ovarian cancer -1.100 4.7e-05
psoriasis 1.200 8.4e-04

 GWAS Trait (1)

Protein-protein Interaction (7)

Gene RIF (3)

AA Sequence

MTKARLFRLWLVLGSVFMILLIIVYWDSAGAAHFYLHTSFSRPHTGPPLPTPGPDRDRELTADSDVDEFL      1 - 70
DKFLSAGVKQSDLPRKETEQPPAPGSMEESVRGYDWSPRDARRSPDQGRQQAERRSVLRGFCANSSLAFP     71 - 140
TKERAFDDIPNSELSHLIVDDRHGAIYCYVPKVACTNWKRVMIVLSGSLLHRGAPYRDPLRIPREHVHNA    141 - 210
SAHLTFNKFWRRYGKLSRHLMKVKLKKYTKFLFVRDPFVRLISAFRSKFELENEEFYRKFAVPMLRLYAN    211 - 280
HTSLPASAREAFRAGLKVSFANFIQYLLDPHTEKLAPFNEHWRQVYRLCHPCQIDYDFVGKLETLDEDAA    281 - 350
QLLQLLQVDRQLRFPPSYRNRTASSWEEDWFAKIPLAWRQQLYKLYEADFVLFGYPKPENLLRD          351 - 414
//

Text Mined References (15)

PMID Year Title