Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.77
PubTator Score 5.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 1.36873844437772E-5
ovarian cancer 8492 1.37982320682649E-5
glioblastoma 5572 2.26698338211723E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 9.21735556249147E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 3.00433820297251E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.70675436584132E-4
psoriasis 6685 8.44203153456089E-4
medulloblastoma, large-cell 6234 0.00138751486431704

Expression

Synonym

Accession Q9NRB3 A4D1Z9 Q502W3 Q9NXY7
Symbols C4S-2
C4ST2
C4ST-2

Gene

PANTHER Protein Class (1)

  Ortholog (11)

 GWAS Trait (1)

Gene RIF (2)

PMID Text
20580388 Observational study of gene-disease association. (HuGE Navigator)
12847091 human D4ST-1, C4ST-1, and S4ST-2 have differential roles in dermatan sulfate biosynthesis

AA Sequence

MTKARLFRLWLVLGSVFMILLIIVYWDSAGAAHFYLHTSFSRPHTGPPLPTPGPDRDRELTADSDVDEFL      1 - 70
DKFLSAGVKQSDLPRKETEQPPAPGSMEESVRGYDWSPRDARRSPDQGRQQAERRSVLRGFCANSSLAFP     71 - 140
TKERAFDDIPNSELSHLIVDDRHGAIYCYVPKVACTNWKRVMIVLSGSLLHRGAPYRDPLRIPREHVHNA    141 - 210
SAHLTFNKFWRRYGKLSRHLMKVKLKKYTKFLFVRDPFVRLISAFRSKFELENEEFYRKFAVPMLRLYAN    211 - 280
HTSLPASAREAFRAGLKVSFANFIQYLLDPHTEKLAPFNEHWRQVYRLCHPCQIDYDFVGKLETLDEDAA    281 - 350
QLLQLLQVDRQLRFPPSYRNRTASSWEEDWFAKIPLAWRQQLYKLYEADFVLFGYPKPENLLRD          351 - 414
//

Text Mined References (13)

PMID Year Title
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
20580388 2010 Natural frequency of polymorphisms linked to the chondroitin 4-sulfotransferase genes and its association with placental malaria.
19946888 2010 Defining the membrane proteome of NK cells.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12847091 2003 Specificities of three distinct human chondroitin/dermatan N-acetylgalactosamine 4-O-sulfotransferases demonstrated using partially desulfated dermatan sulfate as an acceptor: implication of differential roles in dermatan sulfate biosynthesis.
12690205 2003 Human chromosome 7: DNA sequence and biology.
More...