Property Summary

NCBI Gene PubMed Count 39
Grant Count 109
R01 Count 52
Funding $19,008,434.59
PubMed Score 800.26
PubTator Score 3906.63

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NRA2 Q5SZ76 Q8NBR5 Q9UGH0
Symbols SD
AST
NSD
SLD
ISSD
SIASD
SIALIN

Gene

PANTHER Protein Class (2)

Gene RIF (18)

PMID Text
22778404 These data demonstrate that sialin mediates nitrate influx into salivary gland and other cell types.
22632162 FITC-labeled Tat 47-59 peptide upregulates gene expression of solute carrier family 17 (anion/sugar transporter), member 5 (SLC17A5) in U-937 macrophages
22334707 the substrate-binding site of sialin (SLC17A5)
21781115 Human SLC17A5 carrying mutations that causes both phenotypes of Salla disease and mutations that cause infantile sialic acid storage disease showed no transport activity
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20424173 analysis of crucial residues and substrate-induced conformational changes in SLC17 transporter sialin
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19557856 Mutations in the SLC17A5 gene must be considered in two siblings with hypomyelination, even in the absence of sialuria.
18695252 sialin possesses dual physiological functions and acts as a vesicular aspartate/glutamate transporter
More...

AA Sequence

MRSPVRDLARNDGEESTDRTPLLPGAPRAEAAPVCCSARYNLAILAFFGFFIVYALRVNLSVALVDMVDS      1 - 70
NTTLEDNRTSKACPEHSAPIKVHHNQTGKKYQWDAETQGWILGSFFYGYIITQIPGGYVASKIGGKMLLG     71 - 140
FGILGTAVLTLFTPIAADLGVGPLIVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLSISYAGAQLGT    141 - 210
VISLPLSGIICYYMNWTYVFYFFGTIGIFWFLLWIWLVSDTPQKHKRISHYEKEYILSSLRNQLSSQKSV    211 - 280
PWVPILKSLPLWAIVVAHFSYNWTFYTLLTLLPTYMKEILRFNVQENGFLSSLPYLGSWLCMILSGQAAD    281 - 350
NLRAKWNFSTLCVRRIFSLIGMIGPAVFLVAAGFIGCDYSLAVAFLTISTTLGGFCSSGFSINHLDIAPS    351 - 420
YAGILLGITNTFATIPGMVGPVIAKSLTPDNTVGEWQTVFYIAAAINVFGAIFFTLFAKGEVQNWALNDH    421 - 490
HGHRH                                                                     491 - 495
//

Text Mined References (39)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22778404 2012 Sialin (SLC17A5) functions as a nitrate transporter in the plasma membrane.
22334707 2012 Successful prediction of substrate-binding pocket in SLC17 transporter sialin.
21781115 2011 Functional characterization of vesicular excitatory amino acid transport by human sialin.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20424173 2010 Structure-function studies of the SLC17 transporter sialin identify crucial residues and substrate-induced conformational changes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19557856 2009 Free sialic acid storage disease without sialuria.
18695252 2008 Identification of a vesicular aspartate transporter.
More...