Property Summary

NCBI Gene PubMed Count 52
Grant Count 36
R01 Count 20
Funding $5,039,466.45
PubMed Score 113.49
PubTator Score 73.59

Knowledge Summary

Patent

No data available

Expression

Gene RIF (45)

PMID Text
27033449 High glucose-mediated induction of PDGF-C via ChREBP in mesangial cells contributes to the development of glomerular mesangial expansion in diabetes.
26687981 We conclude that PDGF-CC-induced blood-spinal cord barrier dysfunction can contribute to timing of amyotrophic lateral sclerosis onset
25383675 PDGF-C up-regulation was mediated by the human embryonic lethal abnormal vision-like protein HuR, which stabilizes the PDGF-C transcript by binding to two predicted AU-rich elements (AREs) in the 3'-untranslated region (3'-UTR).
24612214 Concomitant upregulation of PDGF-C with VEGF in Glioblastoma tumor cells.
24421315 Platelet-derived growth factor-C (PDGF-C) induces anti-apoptotic effects on macrophages through Akt and Bad phosphorylation.
24269585 Data indicate uPA (plau) and PAI1 (Serpine1) were up-regulated in human PDGF-C Tg mice, suggesting that uPA could be compensating for the loss of tissue-type plasminogen activator (tPA) activity in PDGF-C Tg; tpa KO mice.
24126726 The results indicate that PDGF-C upregulation and calpain-3 downregulation are involved in the aggressiveness of malignant melanoma and suggest that modulators of these proteins
23929039 High PDGF-C expression induces progressive fibrosis, chronic inflammation, neoangiogenesis and sinusoidal congestion resulting in hepatocellular carcinoma.
23784143 Treatment of human neuroblastoma cells or rat primary neurons with HIV-1 Tat downregulates PDGF-C expression
23784143 Treatment of human neuroblastoma cells or rat primary neurons with HIV-1 Tat downregulates PDGF-C expression
More...

AA Sequence

MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHSPRFPHTYPRN      1 - 70
TVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTILGRWCGSGTVPGKQISKGNQI     71 - 140
RIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSALPLDLLNNAITAFSTLEDLIRYLEPERWQL    141 - 210
DLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRC    211 - 280
GGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG         281 - 345
//

Text Mined References (62)

PMID Year Title
27033449 2016 High glucose induces platelet-derived growth factor-C via carbohydrate response element-binding protein in glomerular mesangial cells.
26687981 2016 Presymptomatic activation of the PDGF-CC pathway accelerates onset of ALS neurodegeneration.
25383675 2014 Post-transcriptional up-regulation of PDGF-C by HuR in advanced and stressed breast cancer.
25108383 2014 Genome-wide association analyses identify variants in developmental genes associated with hypospadias.
24612214 2014 Angiogenesis and expression of PDGF-C, VEGF, CD105 and HIF-1? in human glioblastoma.
24421315 2014 Platelet-derived growth factor-C (PDGF-C) induces anti-apoptotic effects on macrophages through Akt and Bad phosphorylation.
24269585 2014 Tissue-type plasminogen activator is not necessary for platelet-derived growth factor-c activation.
24126726 2013 Platelet-derived growth factor C and calpain-3 are modulators of human melanoma cell invasiveness.
23929039 2014 Paracrine activation of hepatic stellate cells in platelet-derived growth factor C transgenic mice: evidence for stromal induction of hepatocellular carcinoma.
23714575 2013 PDGF-C: a new performer in the neurovascular interplay.
More...