Property Summary

NCBI Gene PubMed Count 53
PubMed Score 120.61
PubTator Score 73.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
active Crohn's disease -1.626 8.5e-03
active ulcerative colitis -2.388 4.6e-03
acute quadriplegic myopathy 1.426 3.1e-04
adult high grade glioma 1.600 3.8e-03
aldosterone-producing adenoma -1.515 4.4e-02
Amyotrophic lateral sclerosis 1.489 2.0e-05
astrocytoma 1.100 9.9e-12
Astrocytoma, Pilocytic 2.200 1.5e-06
atypical teratoid / rhabdoid tumor 1.600 5.1e-03
autosomal dominant Emery-Dreifuss muscul... 1.189 1.9e-02
Breast cancer 1.200 1.0e-02
cystic fibrosis 1.226 7.1e-06
dermatomyositis 1.200 9.9e-03
ductal carcinoma in situ -1.100 2.0e-03
ependymoma 1.200 9.7e-04
glioblastoma 1.500 1.4e-03
group 4 medulloblastoma 2.000 1.0e-03
intraductal papillary-mucinous carcinoma... -2.800 1.1e-02
invasive ductal carcinoma 1.754 5.9e-03
lung cancer 1.300 8.7e-03
lung carcinoma -1.400 2.6e-12
oligodendroglioma 1.100 4.6e-07
osteosarcoma 1.226 9.4e-03
ovarian cancer -2.900 1.7e-07
pancreatic cancer 1.800 4.6e-03
pancreatic ductal adenocarcinoma liver m... -1.385 1.3e-02
primitive neuroectodermal tumor 1.100 4.9e-02
psoriasis -1.600 8.3e-07

Gene RIF (42)

AA Sequence

MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHSPRFPHTYPRN      1 - 70
TVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTILGRWCGSGTVPGKQISKGNQI     71 - 140
RIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSALPLDLLNNAITAFSTLEDLIRYLEPERWQL    141 - 210
DLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRC    211 - 280
GGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG         281 - 345
//

Text Mined References (63)

PMID Year Title