Property Summary

NCBI Gene PubMed Count 52
PubMed Score 113.49
PubTator Score 73.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Mesothelioma 40
Disease Target Count P-value
lung carcinoma 2844 2.59730196924396E-12
astrocytoma 1493 9.92322907047935E-12
Breast cancer 3099 5.88582284483415E-9
pilocytic astrocytoma 3086 2.27580120705653E-8
ovarian cancer 8492 1.74978109067732E-7
oligodendroglioma 2849 4.55335420024521E-7
psoriasis 6685 8.34338122022661E-7
osteosarcoma 7933 1.92118096344659E-5
Amyotrophic Lateral Sclerosis 432 1.9857685389063E-5
cystic fibrosis 1670 3.35949506635204E-5
acute quadriplegic myopathy 1157 3.10829705101145E-4
ependymoma 2514 9.74777677494905E-4
group 4 medulloblastoma 1875 0.00101818608323305
glioblastoma 5572 0.00119660638735571
ductal carcinoma in situ 1745 0.00201413071259344
adult high grade glioma 2148 0.00380372679228242
pancreatic cancer 2300 0.00459462399654525
active ulcerative colitis 477 0.0046194911988591
atypical teratoid / rhabdoid tumor 4369 0.00512661603531068
invasive ductal carcinoma 2950 0.00594070799840469
primary pancreatic ductal adenocarcinoma 1271 0.00715720304269751
active Crohn's disease 918 0.00846984413567673
lung cancer 4473 0.00869732981230845
dermatomyositis 967 0.00992045416233986
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0111513615955576
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0189235130517818
aldosterone-producing adenoma 664 0.0440928127404364
primitive neuroectodermal tumor 3031 0.0493869777176866
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0
Disease Target Count Z-score Confidence
Cleft palate 125 3.121 1.6
Cancer 2346 3.082 1.5

Expression

Synonym

Accession Q9NRA1 B4DU34 B9EGR8 Q4W5M9 Q9UL22 PDGF-C
Symbols SCDGF
FALLOTEIN

Gene

PANTHER Protein Class (2)

  Ortholog (13)

Gene RIF (41)

PMID Text
27033449 High glucose-mediated induction of PDGF-C via ChREBP in mesangial cells contributes to the development of glomerular mesangial expansion in diabetes.
26687981 We conclude that PDGF-CC-induced blood-spinal cord barrier dysfunction can contribute to timing of amyotrophic lateral sclerosis onset
25383675 PDGF-C up-regulation was mediated by the human embryonic lethal abnormal vision-like protein HuR, which stabilizes the PDGF-C transcript by binding to two predicted AU-rich elements (AREs) in the 3'-untranslated region (3'-UTR).
24612214 Concomitant upregulation of PDGF-C with VEGF in Glioblastoma tumor cells.
24421315 Platelet-derived growth factor-C (PDGF-C) induces anti-apoptotic effects on macrophages through Akt and Bad phosphorylation.
24269585 Data indicate uPA (plau) and PAI1 (Serpine1) were up-regulated in human PDGF-C Tg mice, suggesting that uPA could be compensating for the loss of tissue-type plasminogen activator (tPA) activity in PDGF-C Tg; tpa KO mice.
24126726 The results indicate that PDGF-C upregulation and calpain-3 downregulation are involved in the aggressiveness of malignant melanoma and suggest that modulators of these proteins
23929039 High PDGF-C expression induces progressive fibrosis, chronic inflammation, neoangiogenesis and sinusoidal congestion resulting in hepatocellular carcinoma.
23784143 Treatment of human neuroblastoma cells or rat primary neurons with HIV-1 Tat downregulates PDGF-C expression
23714575 PDGF-C is both angiogenic and a neuronal survival factor, and it is an important component of neurovascular crosstalk. [Review]
More...

AA Sequence

MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHSPRFPHTYPRN      1 - 70
TVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTILGRWCGSGTVPGKQISKGNQI     71 - 140
RIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSALPLDLLNNAITAFSTLEDLIRYLEPERWQL    141 - 210
DLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRC    211 - 280
GGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG         281 - 345
//

Text Mined References (62)

PMID Year Title
27033449 2016 High glucose induces platelet-derived growth factor-C via carbohydrate response element-binding protein in glomerular mesangial cells.
26687981 2016 Presymptomatic activation of the PDGF-CC pathway accelerates onset of ALS neurodegeneration.
25383675 2014 Post-transcriptional up-regulation of PDGF-C by HuR in advanced and stressed breast cancer.
25108383 2014 Genome-wide association analyses identify variants in developmental genes associated with hypospadias.
24612214 2014 Angiogenesis and expression of PDGF-C, VEGF, CD105 and HIF-1? in human glioblastoma.
24421315 2014 Platelet-derived growth factor-C (PDGF-C) induces anti-apoptotic effects on macrophages through Akt and Bad phosphorylation.
24269585 2014 Tissue-type plasminogen activator is not necessary for platelet-derived growth factor-c activation.
24126726 2013 Platelet-derived growth factor C and calpain-3 are modulators of human melanoma cell invasiveness.
23929039 2014 Paracrine activation of hepatic stellate cells in platelet-derived growth factor C transgenic mice: evidence for stromal induction of hepatocellular carcinoma.
23714575 2013 PDGF-C: a new performer in the neurovascular interplay.
More...