Property Summary

NCBI Gene PubMed Count 167
PubMed Score 211.15
PubTator Score 196.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
lung carcinoma 2844 8.80890174242873E-19
non-small cell lung cancer 2798 1.24976505456646E-13
pilocytic astrocytoma 3086 2.17948079109931E-7
ovarian cancer 8492 3.3033268587565E-6
hepatocellular carcinoma 550 7.42765409149228E-6
glioblastoma 5572 3.75903854816132E-5
medulloblastoma, large-cell 6234 6.01073329183307E-5
ulcerative colitis 2087 1.03843049210673E-4
chronic lymphosyte leukemia 232 1.05837247295285E-4
pediatric high grade glioma 2712 2.00400799608169E-4
primary Sjogren syndrome 789 3.47752610736441E-4
interstitial cystitis 2299 5.07732254086014E-4
lung cancer 4473 6.15958264730142E-4
pancreatic cancer 2300 0.00163443647113059
pancreatic carcinoma 567 0.00163443647113059
tuberculosis 1563 0.00269620819503642
posterior fossa group A ependymoma 1511 0.00285823013200941
head and neck cancer and chronic obstructive pulmonary disease 237 0.00318521420725312
gastric cancer 436 0.00657145312214357
mucosa-associated lymphoid tissue lymphoma 480 0.00747459634023999
osteosarcoma 7933 0.0205272446899897
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0274312363681978
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0460357301022982
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Lupus erythematosus 80 3.428 1.7
Influenza 142 3.172 1.6
Cancer 2346 3.051 1.5

Expression

Synonym

Accession Q9NR97 B3Y654 D1CS70 D1CS76 Q495P4 Q6UXL6 Q9NYG9
Symbols CD288

Gene

PANTHER Protein Class (1)

PDB

3W3G   3W3J   3W3K   3W3L   3W3M   3W3N   3WN4   4QBZ   4QC0   4R07   4R08   4R09   4R0A   4R6A   5AWA   5AWB   5AWC   5AWD   5HDH  

  Ortholog (10)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

Gene RIF (147)

PMID Text
26929371 TLR8 with the uncleaved Z-loop is unable to form a dimer. The uncleaved Z-loop located on the ascending lateral face prevents the approach of the dimerization partner by steric hindrance.
26725554 TLR7 and 8 polymorphisms may play a considerable role in the pathogenesis of asthma.
26556310 Comparison of present and previous association studies reveals contradictory results for common variants. Thus, no associations exist between genetic variation in TLR8 and AR.
26545385 Identified human TLR8 as functional TLR13 equivalent that promiscuously senses ssRNA.
26486764 Results suggest a relationship between the TLR8 and the susceptibility to Crohn's disease and Behcet's disease.
26483222 TLR7 and TLR8 may be involved in the pathogenesis of brain and lung damages caused by severe EV71 infection.
26466955 Knockdown of LRRC59 reduced TLR3-, 8-, and 9-mediated, but not TLR4-mediated, signaling.
26455634 TLR8 polymorphisms seem to be related to non-progression of liver fibrosis in HIV/HCV coinfected patients, particularly in males and those patients infected with GT1.
26315138 Results show that TLR7 and TLR8 on trophoblastic cells play an important role in the prevention of intrauterine HBV transmission by inhibiting HBV translocation across trophoblasts.
26202481 the activation of TLR8 by bi-specific si-RNA for the production of INFbeta, was investigated.
More...

AA Sequence

MENMFLQSSMLTCIFLLISGSCELCAEENFSRSYPCDEKKQNDSVIAECSNRRLQEVPQTVGKYVTELDL      1 - 70
SDNFITHITNESFQGLQNLTKINLNHNPNVQHQNGNPGIQSNGLNITDGAFLNLKNLRELLLEDNQLPQI     71 - 140
PSGLPESLTELSLIQNNIYNITKEGISRLINLKNLYLAWNCYFNKVCEKTNIEDGVFETLTNLELLSLSF    141 - 210
NSLSHVPPKLPSSLRKLFLSNTQIKYISEEDFKGLINLTLLDLSGNCPRCFNAPFPCVPCDGGASINIDR    211 - 280
FAFQNLTQLRYLNLSSTSLRKINAAWFKNMPHLKVLDLEFNYLVGEIASGAFLTMLPRLEILDLSFNYIK    281 - 350
GSYPQHINISRNFSKLLSLRALHLRGYVFQELREDDFQPLMQLPNLSTINLGINFIKQIDFKLFQNFSNL    351 - 420
EIIYLSENRISPLVKDTRQSYANSSSFQRHIRKRRSTDFEFDPHSNFYHFTRPLIKPQCAAYGKALDLSL    421 - 490
NSIFFIGPNQFENLPDIACLNLSANSNAQVLSGTEFSAIPHVKYLDLTNNRLDFDNASALTELSDLEVLD    491 - 560
LSYNSHYFRIAGVTHHLEFIQNFTNLKVLNLSHNNIYTLTDKYNLESKSLVELVFSGNRLDILWNDDDNR    561 - 630
YISIFKGLKNLTRLDLSLNRLKHIPNEAFLNLPASLTELHINDNMLKFFNWTLLQQFPRLELLDLRGNKL    631 - 700
LFLTDSLSDFTSSLRTLLLSHNRISHLPSGFLSEVSSLKHLDLSSNLLKTINKSALETKTTTKLSMLELH    701 - 770
GNPFECTCDIGDFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSLELTTCVSDVTAVILFFFTFFITT    771 - 840
MVMLAALAHHLFYWDVWFIYNVCLAKVKGYRSLSTSQTFYDAYISYDTKDASVTDWVINELRYHLEESRD    841 - 910
KNVLLCLEERDWDPGLAIIDNLMQSINQSKKTVFVLTKKYAKSWNFKTAFYLALQRLMDENMDVIIFILL    911 - 980
EPVLQHSQYLRLRQRICKSSILQWPDNPKAEGLFWQTLRNVVLTENDSRYNNMYVDSIKQY             981 - 1041
//

Text Mined References (169)

PMID Year Title
26929371 2016 Autoinhibition and relief mechanism by the proteolytic processing of Toll-like receptor 8.
26725554 2015 Associations of Toll-like receptor 7 and 8 Polymorphisms with Asthma and Asthma-related Phenotypes in a Chinese Han Population.
26556310 2016 Characterization of genetic variation in TLR8 in relation to allergic rhinitis.
26545385 2015 Human TLR8 senses UR/URR motifs in bacterial and mitochondrial RNA.
26486764 Association of haplotypes of the TLR8 locus with susceptibility to Crohn's and Behçet's diseases.
26483222 2015 [Expression and significance of toll-like receptors 7 and 8 in brain and lung tissues of death cases caused by EV71 infection].
26466955 2015 LRRC59 Regulates Trafficking of Nucleic Acid-Sensing TLRs from the Endoplasmic Reticulum via Association with UNC93B1.
26455634 2015 Toll-like receptor 8 (TLR8) polymorphisms are associated with non-progression of chronic hepatitis C in HIV/HCV coinfected patients.
26315138 2015 Roles of Toll-like Receptor 7 and 8 in Prevention of Intrauterine Transmission of Hepatitis B Virus.
26202481 2015 Negative feedback circuit for toll like receptor-8 activation in human embryonic Kidney 293 using outer membrane vesicle delivered bi-specific siRNA.
More...