Property Summary

Ligand Count 21
NCBI Gene PubMed Count 184
PubMed Score 232.55
PubTator Score 196.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma 1.400 3.9e-03
Astrocytoma, Pilocytic 1.800 2.8e-07
chronic lymphosyte leukemia -1.200 1.1e-04
ependymoma 1.100 1.7e-03
gastric cancer 1.200 6.6e-03
glioblastoma 1.500 3.8e-05
head and neck cancer and chronic obstruc... 1.800 3.2e-03
hepatocellular carcinoma 1.200 8.0e-03
interstitial cystitis 1.300 3.4e-03
intraductal papillary-mucinous carcinoma... -1.100 2.7e-02
intraductal papillary-mucinous neoplasm ... -1.400 4.6e-02
lung cancer -1.700 6.2e-04
lung carcinoma -2.100 8.8e-19
medulloblastoma, large-cell 1.100 6.0e-05
mucosa-associated lymphoid tissue lympho... 1.705 7.5e-03
non-small cell lung cancer -1.905 1.2e-13
osteosarcoma -1.858 2.1e-02
ovarian cancer -2.700 3.3e-06
pancreatic cancer 1.800 1.6e-03
pancreatic carcinoma 1.800 1.6e-03
primary Sjogren syndrome 1.800 3.5e-04
tuberculosis 1.700 5.3e-04
ulcerative colitis 2.400 1.0e-04

 GWAS Trait (1)

Gene RIF (164)

AA Sequence

MENMFLQSSMLTCIFLLISGSCELCAEENFSRSYPCDEKKQNDSVIAECSNRRLQEVPQTVGKYVTELDL      1 - 70
SDNFITHITNESFQGLQNLTKINLNHNPNVQHQNGNPGIQSNGLNITDGAFLNLKNLRELLLEDNQLPQI     71 - 140
PSGLPESLTELSLIQNNIYNITKEGISRLINLKNLYLAWNCYFNKVCEKTNIEDGVFETLTNLELLSLSF    141 - 210
NSLSHVPPKLPSSLRKLFLSNTQIKYISEEDFKGLINLTLLDLSGNCPRCFNAPFPCVPCDGGASINIDR    211 - 280
FAFQNLTQLRYLNLSSTSLRKINAAWFKNMPHLKVLDLEFNYLVGEIASGAFLTMLPRLEILDLSFNYIK    281 - 350
GSYPQHINISRNFSKLLSLRALHLRGYVFQELREDDFQPLMQLPNLSTINLGINFIKQIDFKLFQNFSNL    351 - 420
EIIYLSENRISPLVKDTRQSYANSSSFQRHIRKRRSTDFEFDPHSNFYHFTRPLIKPQCAAYGKALDLSL    421 - 490
NSIFFIGPNQFENLPDIACLNLSANSNAQVLSGTEFSAIPHVKYLDLTNNRLDFDNASALTELSDLEVLD    491 - 560
LSYNSHYFRIAGVTHHLEFIQNFTNLKVLNLSHNNIYTLTDKYNLESKSLVELVFSGNRLDILWNDDDNR    561 - 630
YISIFKGLKNLTRLDLSLNRLKHIPNEAFLNLPASLTELHINDNMLKFFNWTLLQQFPRLELLDLRGNKL    631 - 700
LFLTDSLSDFTSSLRTLLLSHNRISHLPSGFLSEVSSLKHLDLSSNLLKTINKSALETKTTTKLSMLELH    701 - 770
GNPFECTCDIGDFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSLELTTCVSDVTAVILFFFTFFITT    771 - 840
MVMLAALAHHLFYWDVWFIYNVCLAKVKGYRSLSTSQTFYDAYISYDTKDASVTDWVINELRYHLEESRD    841 - 910
KNVLLCLEERDWDPGLAIIDNLMQSINQSKKTVFVLTKKYAKSWNFKTAFYLALQRLMDENMDVIIFILL    911 - 980
EPVLQHSQYLRLRQRICKSSILQWPDNPKAEGLFWQTLRNVVLTENDSRYNNMYVDSIKQY             981 - 1041
//

Text Mined References (186)

PMID Year Title