Property Summary

NCBI Gene PubMed Count 556
Grant Count 882
R01 Count 418
Funding $124,312,519.39
PubMed Score 1085.68
PubTator Score 1152.06

Knowledge Summary

Patent

No data available

Synonym

Gene

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
504734 screening 734 / 0 / 342966 Fluorescence-based cell-based primary high throughput screening assay to identify inhibitors of TLR9-MyD88 binding.
504750 summary 0 / 0 / 0 Summary of the probe development efforts to identify inhibitors of human Toll-like receptor 9 (TLR9)
540250 screening 345 / 0 / 330 Fluorescence-based cell-based high throughput confirmation assay for inhibitors of TLR9-MyD88 binding
588340 confirmatory 168 / 0 / 67 Fluorescence-based cell-based high throughput dose response assay for inhibitors of TLR9-MyD88 binding
720521 confirmatory 3 / 0 / 0 Late stage assay provider counterscreen for TLR9 inhibitors: Luminescence-based assay to identify inhibitors of TLR9-dependent cell activation using RAW264.7 cells

Gene RIF (563)

PMID Text
27026438 Multi-walled carbon nanotube induces injury or necrosis of lung epithelial cells and DNA damage via HMGB1/RAGE/TLR9 pathway.
26903634 Data show that differences in codon bias limit Toll-like receptor 7 (TLR7) expression relative to Toll-like receptor 9 (TLR9).
26780557 9-mer hairpin and G-quadruplex DNA fragments are nuclease-resistant DNA structures that can act as invasion-inducing TLR9 ligands.
26759164 In active rheumatoid arthritis patients, both TLR9 and TLR2 expression levels are increased in monocyte subsets.
26723518 Increased expression of TLR7 and TLR9 in myasthenia gravis thymus is accompanied by active Epstein-Barr virus infection.
26648480 Results indicate that heterodimerization of GCA and TLR9 is important for TLR9-mediated downstream signaling and might serve to fine tune processes against viral infection.
26632396 The present study suggested that the TLR9 -1237T/C polymorphism might act as a risk factor in the development of IBDs, particularly in Caucasians.
26620361 contributes to human adenovirus type 7 vector-induced B cell cross-presentation
26613957 IRF5 and IRF8, two transcription factors with opposing functions, control TLR9 signaling in human plasmacytoid dendritic cells.
26569074 expression pattern of TLR2 and TLR9 does not vary greatly from normal to precancerous lesions
More...

AA Sequence

MGFCRSALHPLSLLVQAIMLAMTLALGTLPAFLPCELQPHGLVNCNWLFLKSVPHFSMAAPRGNVTSLSL      1 - 70
SSNRIHHLHDSDFAHLPSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTFLAVPTLEELNLSYNNIMTVPA     71 - 140
LPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYYKNPCRQALEVAPGALLGLGNLTHLSLKYNN    141 - 210
LTVVPRNLPSSLEYLLLSYNRIVKLAPEDLANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTF    211 - 280
SHLSRLEGLVLKDSSLSWLNASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNYQKRVS    281 - 350
FAHLSLAPSFGSLVALKELDMHGIFFRSLDETTLRPLARLPMLQTLRLQMNFINQAQLGIFRAFPGLRYV    351 - 420
DLSDNRISGASELTATMGEADGGEKVWLQPGDLAPAPVDTPSSEDFRPNCSTLNFTLDLSRNNLVTVQPE    421 - 490
MFAQLSHLQCLRLSHNCISQAVNGSQFLPLTGLQVLDLSHNKLDLYHEHSFTELPRLEALDLSYNSQPFG    491 - 560
MQGVGHNFSFVAHLRTLRHLSLAHNNIHSQVSQQLCSTSLRALDFSGNALGHMWAEGDLYLHFFQGLSGL    561 - 630
IWLDLSQNRLHTLLPQTLRNLPKSLQVLRLRDNYLAFFKWWSLHFLPKLEVLDLAGNQLKALTNGSLPAG    631 - 700
TRLRRLDVSCNSISFVAPGFFSKAKELRELNLSANALKTVDHSWFGPLASALQILDVSANPLHCACGAAF    701 - 770
MDFLLEVQAAVPGLPSRVKCGSPGQLQGLSIFAQDLRLCLDEALSWDCFALSLLAVALGLGVPMLHHLCG    771 - 840
WDLWYCFHLCLAWLPWRGRQSGRDEDALPYDAFVVFDKTQSAVADWVYNELRGQLEECRGRWALRLCLEE    841 - 910
RDWLPGKTLFENLWASVYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLEDRKDVVVLVILSPDGRRSRY    911 - 980
VRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHFYNRNFCQGPTAE                      981 - 1032
//

Text Mined References (558)

PMID Year Title
27026438 2016 Multi-walled carbon nanotube induces nitrative DNA damage in human lung epithelial cells via HMGB1-RAGE interaction and Toll-like receptor 9 activation.
26903634 2016 Differences in codon bias and GC content contribute to the balanced expression of TLR7 and TLR9.
26780557 2016 Telomeric G-quadruplex-forming DNA fragments induce TLR9-mediated and LL-37-regulated invasion in breast cancer cells in vitro.
26759164 2016 Overexpression of TLR2 and TLR9 on monocyte subsets of active rheumatoid arthritis patients contributes to enhance responsiveness to TLR agonists.
26723518 2016 Increased expression of Toll-like receptors 7 and 9 in myasthenia gravis thymus characterized by active Epstein-Barr virus infection.
26648480 2016 Grancalcin (GCA) modulates Toll-like receptor 9 (TLR9) mediated signaling through its direct interaction with TLR9.
26632396 2016 Association between Toll-Like Receptor 9-1237T/C Polymorphism and the Susceptibility of Inflammatory Bowel Diseases: A Meta-Analysis.
26620361 2016 Efficient induction of cross-presentating human B cell by transduction with human adenovirus type 7 vector.
26613957 2016 IRF5 and IRF8 modulate the CAL-1 human plasmacytoid dendritic cell line response following TLR9 ligation.
26569074 2015 A study of the expression and localization of toll-like receptors 2 and 9 in different grades of cervical intraepithelial neoplasia and squamous cell carcinoma.
More...