Property Summary

NCBI Gene PubMed Count 14
PubMed Score 20.53
PubTator Score 17.29

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.600 4.4e-07
Breast cancer 1.600 7.5e-13
dermatomyositis -1.200 4.0e-03
ependymoma 1.600 4.8e-08
glioblastoma 1.800 8.5e-05
malignant mesothelioma 1.200 6.8e-05
osteosarcoma -3.624 1.8e-07
pediatric high grade glioma 1.300 8.8e-05
psoriasis -1.300 3.7e-05
tuberculosis 1.100 8.7e-05

Gene RIF (4)

AA Sequence

MERPPPRAAGRDPSALRAEAPWLRAEGPGPRAAPVTVPTPPQGSSVGGGFAGLEFARPQESEPRASDLGA      1 - 70
PRTWTGAAAGPRTPSAHIPVPAQRATPGKARLDEVMAAAALTSLSTSPLLLGAPVAAFSPEPGLEPWKEA     71 - 140
LVRPPGSYSSSSNSGDWGWDLASDQSSPSTPSPPLPPEAAHFLFGEPTLRKRKSPAQVMFQCLWKSCGKV    141 - 210
LSTASAMQRHIRLVHLGRQAEPEQSDGEEDFYYTELDVGVDTLTDGLSSLTPVSPTASMPPAFPRLELPE    211 - 280
LLEPPALPSPLRPPAPPLPPPPVLSTVANPQSCHSDRVYQGCLTPARLEPQPTEVGACPPALSSRIGVTL    281 - 350
RKPRGDAKKCRKVYGMERRDLWCTACRWKKACQRFLD                                     351 - 387
//

Text Mined References (15)

PMID Year Title