Property Summary

NCBI Gene PubMed Count 27
Grant Count 14
R01 Count 9
Funding $1,985,301.34
PubMed Score 42.02
PubTator Score 30.83

Knowledge Summary

Patent (15,169)

Expression

  Differential Expression (15)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
493046 confirmatory 0 / 0 / 5 Mode of action assay-Specificity test for the KCNQ2 activators in the KCNQ5 expressing cells

Gene RIF (14)

PMID Text
25672891 suggestive loci for periodontitis: KCNQ5 on chromosome 6q13 in a Japanese population. study should contribute to further understanding of genetic factors for enhanced susceptibility to periodontitis.
25127363 rs9351963 in KCNQ5 is a possible predictive factor of incidence of diarrhea in cancer patients treated with irinotecan chemotherapy.
24855057 Kv7.1/Kv7.5 form heterotetrameric channels increasing the diversity of structures which fine-tune blood vessel reactivity. The lipid raft localization of Kv7.1/Kv7.5 heteromers provides efficient spatial and temporal regulation of smooth muscle function.
24297175 Differential protein kinase C-dependent modulation of Kv7.4 and Kv7.5 subunits of vascular Kv7 channels.
22347474 characterized the cell-type specific spatial organization of the kcnq5 gene locus mediated by CTCF in detail using chromosome conformation capture (3C) and 3C-derived techniques
22190306 The results of this study indicated that Kv7.5 contributes to the spatial regulation of KCNE3.
21730298 Data show that KCNQ1 mRNA expression was increased and KCNQ5 decreased in the preterm preeclamptic women.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGG      1 - 70
GGGGLRESRRGKQGARMSLLGKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLLVFGC     71 - 140
LILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIWSAGCCCRYRGWQGRLRFARKPFCVIDTIVL    141 - 210
IASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFS    211 - 280
SFLVYLVEKDANKEFSTYADALWWGTITLTTIGYGDKTPLTWLGRLLSAGFALLGISFFALPAGILGSGF    281 - 350
ALKVQEQHRQKHFEKRRNPAANLIQCVWRSYAADEKSVSIATWKPHLKALHTCSPTKKEQGEASSSQKLS    351 - 420
FKERVRMASPRGQSIKSRQASVGDRRSPSTDITAEGSPTKVQKSWSFNDRTRFRPSLRLKSSQPKPVIDA    421 - 490
DTALGTDDVYDEKGCQCDVSVEDLTPPLKTVIRAIRIMKFHVAKRKFKETLRPYDVKDVIEQYSAGHLDM    491 - 560
LCRIKSLQTRVDQILGKGQITSDKKSREKITAEHETTDDLSMLGRVVKVEKQVQSIESKLDCLLDIYQQV    561 - 630
LRKGSASALALASFQIPPFECEQTSDYQSPVDSKDLSGSAQNSGCLSRSTSANISRGLQFILTPNEFSAQ    631 - 700
TFYALSPTMHSQATQVPISQSDGSAVAATNTIANQINTAPKPAAPTTLQIPPPLPAIKHLPRPETLHPNP    701 - 770
AGLQESISDVTTCLVASKENVQVAQSNLTKDRSMRKSFDMGGETLLSVCPMVPKDLGKSLSVQNLIRSTE    771 - 840
ELNIQLSGSESSGSRGSQDFYPKWRESKLFITDEEVGPEETETDTFDAAPQPAREAAFASDSLRTGRSRS    841 - 910
SQSICKAGESTDALSLPHVKLK                                                    911 - 932
//

Text Mined References (30)

PMID Year Title
25672891 2015 A genome-wide association study of periodontitis in a Japanese population.
25127363 2014 Application of a combination of a knowledge-based algorithm and 2-stage screening to hypothesis-free genomic data on irinotecan-treated patients for identification of a candidate single nucleotide polymorphism related to an adverse effect.
24855057 2014 Functional assembly of Kv7.1/Kv7.5 channels with emerging properties on vascular muscle physiology.
24297175 2014 Differential protein kinase C-dependent modulation of Kv7.4 and Kv7.5 subunits of vascular Kv7 channels.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22347474 2012 CTCF mediates the cell-type specific spatial organization of the Kcnq5 locus and the local gene regulation.
22190306 2012 Targeting of Kv7.5 (KCNQ5)/KCNE channels to surface microdomains of cell membranes.
21730298 2011 Novel expression and regulation of voltage-dependent potassium channels in placentas from women with preeclampsia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...