Property Summary

Ligand Count 10
NCBI Gene PubMed Count 30
PubMed Score 46.11
PubTator Score 30.83

Knowledge Summary

Patent (15,169)

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.502 9.2e-04
Amyotrophic lateral sclerosis 1.849 1.7e-06
astrocytic glioma -2.000 1.2e-02
atypical teratoid / rhabdoid tumor -3.900 2.4e-05
cystic fibrosis 1.459 1.8e-05
ependymoma -3.100 2.0e-02
glioblastoma -1.900 9.5e-03
medulloblastoma -1.800 3.3e-02
medulloblastoma, large-cell -2.400 4.6e-02
oligodendroglioma -2.100 2.2e-02
osteosarcoma -3.282 7.7e-05
pediatric high grade glioma -2.100 1.7e-02
pituitary cancer 3.100 3.2e-03
primitive neuroectodermal tumor -4.600 4.2e-04
tuberculosis 1.200 1.4e-06

Gene RIF (17)

AA Sequence

MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLLLGTRAATLGG      1 - 70
GGGGLRESRRGKQGARMSLLGKPLSYTSSQSCRRNVKYRRVQNYLYNVLERPRGWAFIYHAFVFLLVFGC     71 - 140
LILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIWSAGCCCRYRGWQGRLRFARKPFCVIDTIVL    141 - 210
IASIAVVSAKTQGNIFATSALRSLRFLQILRMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFS    211 - 280
SFLVYLVEKDANKEFSTYADALWWGTITLTTIGYGDKTPLTWLGRLLSAGFALLGISFFALPAGILGSGF    281 - 350
ALKVQEQHRQKHFEKRRNPAANLIQCVWRSYAADEKSVSIATWKPHLKALHTCSPTKKEQGEASSSQKLS    351 - 420
FKERVRMASPRGQSIKSRQASVGDRRSPSTDITAEGSPTKVQKSWSFNDRTRFRPSLRLKSSQPKPVIDA    421 - 490
DTALGTDDVYDEKGCQCDVSVEDLTPPLKTVIRAIRIMKFHVAKRKFKETLRPYDVKDVIEQYSAGHLDM    491 - 560
LCRIKSLQTRVDQILGKGQITSDKKSREKITAEHETTDDLSMLGRVVKVEKQVQSIESKLDCLLDIYQQV    561 - 630
LRKGSASALALASFQIPPFECEQTSDYQSPVDSKDLSGSAQNSGCLSRSTSANISRGLQFILTPNEFSAQ    631 - 700
TFYALSPTMHSQATQVPISQSDGSAVAATNTIANQINTAPKPAAPTTLQIPPPLPAIKHLPRPETLHPNP    701 - 770
AGLQESISDVTTCLVASKENVQVAQSNLTKDRSMRKSFDMGGETLLSVCPMVPKDLGKSLSVQNLIRSTE    771 - 840
ELNIQLSGSESSGSRGSQDFYPKWRESKLFITDEEVGPEETETDTFDAAPQPAREAAFASDSLRTGRSRS    841 - 910
SQSICKAGESTDALSLPHVKLK                                                    911 - 932
//

Text Mined References (33)

PMID Year Title