Property Summary

NCBI Gene PubMed Count 31
PubMed Score 16.66
PubTator Score 16.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
non-small cell lung cancer 2798 1.86836806067415E-17
malignant mesothelioma 3163 1.49512328798908E-9
pituitary cancer 1972 4.56128040493249E-6
medulloblastoma, large-cell 6234 8.18267079295896E-6
ovarian cancer 8492 1.47049429860335E-5
posterior fossa group B ependymoma 1530 1.95739995085495E-5
osteosarcoma 7933 3.66738770106205E-5
cystic fibrosis 1670 2.32162865749351E-4
atypical teratoid / rhabdoid tumor 4369 7.97274921102671E-4
medulloblastoma 1524 0.00123001002153186
active ulcerative colitis 477 0.00461602809333549
active Crohn's disease 918 0.00539853122814227
lung cancer 4473 0.00637247754757514
astrocytic glioma 2241 0.00708412574133377
glioblastoma 5572 0.0130126035836959
primitive neuroectodermal tumor 3031 0.0245630991497198
oligodendroglioma 2849 0.0406047410285358
Disease Target Count Z-score Confidence
Hemolytic anemia 70 0.0 2.0
Rheumatoid Arthritis 1171 0.0 1.0
Disease Target Count Z-score Confidence
Hypochromic anemia 6 3.086 1.5

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma -5.500 0.000
astrocytic glioma -1.100 0.007
posterior fossa group B ependymoma -1.800 0.000
oligodendroglioma -1.200 0.041
osteosarcoma -2.122 0.000
cystic fibrosis 1.482 0.000
atypical teratoid / rhabdoid tumor -1.800 0.001
glioblastoma -1.100 0.013
medulloblastoma -1.300 0.001
medulloblastoma, large-cell -2.600 0.000
primitive neuroectodermal tumor -1.400 0.025
non-small cell lung cancer -1.230 0.000
lung cancer -1.200 0.006
active Crohn's disease 2.210 0.005
active ulcerative colitis 2.484 0.005
ovarian cancer -1.600 0.000
pituitary cancer 1.500 0.000

Synonym

Accession Q9NR81 A8K5U7 Q4FZB6 Q4QQI5 Q4QQQ0 Q59F00 Q6NUN3 Q7Z4U2 Q7Z5T2 Q9H7T4
Symbols GEF3
STA3
XPLN

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

Gene RIF (12)

PMID Text
25494542 ARHGEF3 has a crucial role in myeloid differentiation.
24840563 ARHGEF3 and RHOA are potential regulators of a number of genes in bone cells, with influences on ACTA2 evident in both osteoblast-like and osteoclast-like cells.
24043828 XPLN is an endogenous inhibitor of mTORC2.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19911011 Observational study of gene-disease association. (HuGE Navigator)
19727905 the association between rs7646054 in ARHGEF3 and bone mineral density observed in Caucasians was not replicated in the chinese samples.
19727905 Observational study of gene-disease association. (HuGE Navigator)
19427924 Observational study of gene-disease association. (HuGE Navigator)
19110211 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18499081 genetic variation in ARHGEF3 plays a role in the determination of bone density in Caucasian women. This data implicates the RhoGTPase-RhoGEF pathway in osteoporosis.
More...

AA Sequence

MVAKDYPFYLTVKRANCSLELPPASGPAKDAEEPSNKRVKPLSRVTSLANLIPPVKATPLKRFSQTLQRS      1 - 70
ISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKEIKRQEAIFELSQGEEDLIED     71 - 140
LKLAKKAYHDPMLKLSIMTEQELNQIFGTLDSLIPLHEELLSQLRDVRKPDGSTEHVGPILVGWLPCLSS    141 - 210
YDSYCSNQVAAKALLDHKKQDHRVQDFLQRCLESPFSRKLDLWNFLDIPRSRLVKYPLLLREILRHTPND    211 - 280
NPDQQHLEEAINIIQGIVAEINTKTGESECRYYKERLLYLEEGQKDSLIDSSRVLCCHGELKNNRGVKLH    281 - 350
VFLFQEVLVITRAVTHNEQLCYQLYRQPIPVKDLLLEDLQDGEVRLGGSLRGAFSNNERIKNFFRVSFKN    351 - 420
GSQSQTHSLQANDTFNKQQWLNCIRQAKETVLCAAGQAGVLDSEGSFLNPTTGSRELQGETKLEQMDQSD    421 - 490
SESDCSMDTSEVSLDCERMEQTDSSCGNSRHGESNV                                      491 - 526
//

Text Mined References (32)

PMID Year Title
25494542 2015 ARHGEF3 controls HDACi-induced differentiation via RhoA-dependent pathways in acute myeloid leukemias.
25416956 2014 A proteome-scale map of the human interactome network.
24840563 2014 Influence of ARHGEF3 and RHOA knockdown on ACTA2 and other genes in osteoblasts and osteoclasts.
24043828 2013 XPLN is an endogenous inhibitor of mTORC2.
24026423 2014 A genome- and phenome-wide association study to identify genetic variants influencing platelet count and volume and their pleiotropic effects.
23263863 2013 GWAS of blood cell traits identifies novel associated loci and epistatic interactions in Caucasian and African-American children.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
21452313 2011 Genome-wide association study of rheumatoid arthritis in Koreans: population-specific loci as well as overlap with European susceptibility loci.
More...