Property Summary

NCBI Gene PubMed Count 33
PubMed Score 19.99
PubTator Score 16.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
active Crohn's disease 2.210 5.4e-03
active ulcerative colitis 2.484 4.6e-03
astrocytic glioma -1.100 7.1e-03
atypical teratoid / rhabdoid tumor -1.800 8.0e-04
cystic fibrosis 1.482 2.3e-04
ependymoma -1.600 4.2e-02
glioblastoma -1.100 1.3e-02
lung cancer -1.200 6.4e-03
malignant mesothelioma -5.500 1.5e-09
medulloblastoma -1.300 1.2e-03
medulloblastoma, large-cell -2.600 8.2e-06
non-small cell lung cancer -1.230 1.9e-17
oligodendroglioma -1.200 4.1e-02
osteosarcoma -2.122 3.7e-05
ovarian cancer -1.600 1.5e-05
pituitary cancer 1.500 4.6e-06
primitive neuroectodermal tumor -1.400 2.5e-02

Gene RIF (14)

AA Sequence

MVAKDYPFYLTVKRANCSLELPPASGPAKDAEEPSNKRVKPLSRVTSLANLIPPVKATPLKRFSQTLQRS      1 - 70
ISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKEIKRQEAIFELSQGEEDLIED     71 - 140
LKLAKKAYHDPMLKLSIMTEQELNQIFGTLDSLIPLHEELLSQLRDVRKPDGSTEHVGPILVGWLPCLSS    141 - 210
YDSYCSNQVAAKALLDHKKQDHRVQDFLQRCLESPFSRKLDLWNFLDIPRSRLVKYPLLLREILRHTPND    211 - 280
NPDQQHLEEAINIIQGIVAEINTKTGESECRYYKERLLYLEEGQKDSLIDSSRVLCCHGELKNNRGVKLH    281 - 350
VFLFQEVLVITRAVTHNEQLCYQLYRQPIPVKDLLLEDLQDGEVRLGGSLRGAFSNNERIKNFFRVSFKN    351 - 420
GSQSQTHSLQANDTFNKQQWLNCIRQAKETVLCAAGQAGVLDSEGSFLNPTTGSRELQGETKLEQMDQSD    421 - 490
SESDCSMDTSEVSLDCERMEQTDSSCGNSRHGESNV                                      491 - 526
//

Text Mined References (34)

PMID Year Title