Property Summary

NCBI Gene PubMed Count 20
Grant Count 10
R01 Count 9
Funding $521,308.12
PubMed Score 25.07
PubTator Score 24.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
esophageal adenocarcinoma -2.000 0.018
ependymoma -1.500 0.000
glioblastoma -2.300 0.001
medulloblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -3.200 0.000
medulloblastoma, large-cell -3.800 0.000
primitive neuroectodermal tumor -1.400 0.004
breast carcinoma -1.400 0.000
pediatric high grade glioma -2.100 0.000
pilocytic astrocytoma -1.400 0.000
subependymal giant cell astrocytoma -1.567 0.045
lung adenocarcinoma -1.300 0.000
non-inflammatory breast cancer -1.200 0.049
spina bifida -1.179 0.040
ductal carcinoma in situ -1.200 0.006
invasive ductal carcinoma -1.700 0.001
ovarian cancer -1.100 0.001

Gene RIF (8)

PMID Text
25539852 these results demonstrate potent anti-inflammatory effects by HGF and delineate a key role of Asef in the mediation of the HGF barrier protective and anti-inflammatory effects.
25101856 These data demonstrate, that in addition to microtubule-independent Tiam1 activation, HGF engages additional microtubule- and APC-dependent pathway of Asef activation.
23941980 Expression of Asef was associated with lower estimated glomerular filtration rate in kidney disease.
22543972 Expression of ARHGEF4 (Rho guanine nucleotide exchange factor 4) is restricted to the brain and may regulate the actin cytoskeletal network, cell morphology and migration, and neuronal function
21788986 structures thus elucidate the molecular mechanism of Asef recognition by APC
19628279 Forced expression of Asef in vitro induced and maintained proliferation of haemaopoietic progenitor cells and co-operated with TEL-AML1 greatly to enhance proliferation and haemopoietic colony size
19525225 Asef and APC function downstream of HGF and PI3-kinase, and play critical roles in growth factor-mediated regulation of cell morphology and migration
18653540 Positive role of Tyr94 phosphorylation in EGF-induced Asef activation following the activation of Rac1.

AA Sequence

MPWEEPAGEKPSCSHSQKAFHMEPAQKPCFTTDMVTWALLCISAETVRGEAPSQPRGIPHRSPVSVDDLW      1 - 70
LEKTQRKKLQKQAHVERRLHIGAVHKDGVKCWRKTIITSPESLNLPRRSHPLSQSAPTGLNHMGWPEHTP     71 - 140
GTAMPDGALDTAVCADEVGSEEDLYDDLHSSSHHYSHPGGGGEQLAINELISDGSVVCAEALWDHVTMDD    141 - 210
QELGFKAGDVIEVMDATNREWWWGRVADGEGWFPASFVRLRVNQDEPADDDAPLAGNSGAEDGGAEAQSS    211 - 280
KDQMRTNVINEILSTERDYIKHLRDICEGYVRQCRKRADMFSEEQLRTIFGNIEDIYRCQKAFVKALEQR    281 - 350
FNRERPHLSELGACFLEHQADFQIYSEYCNNHPNACVELSRLTKLSKYVYFFEACRLLQKMIDISLDGFL    351 - 420
LTPVQKICKYPLQLAELLKYTHPQHRDFKDVEAALHAMKNVAQLINERKRRLENIDKIAQWQSSIEDWEG    421 - 490
EDLLVRSSELIYSGELTRVTQPQAKSQQRMFFLFDHQLIYCKKDLLRRDVLYYKGRLDMDGLEVVDLEDG    491 - 560
KDRDLHVSIKNAFRLHRGATGDSHLLCTRKPEQKQRWLKAFAREREQVQLDQETGFSITELQRKQAMLNA    561 - 630
SKQQVTGKPKAVGRPCYLTRQKHPALPSNRPQQQVLVLAEPRRKPSTFWHSISRLAPFRK              631 - 690
//

Text Mined References (24)

PMID Year Title
25539852 2015 Asef mediates HGF protective effects against LPS-induced lung injury and endothelial barrier dysfunction.
25101856 2014 Hepatocyte growth factor triggers distinct mechanisms of Asef and Tiam1 activation to induce endothelial barrier enhancement.
23941980 2013 Association of Asef and Cdc42 expression to tubular injury in diseased human kidney.
22543972 2012 Small rare recurrent deletions and reciprocal duplications in 2q21.1, including brain-specific ARHGEF4 and GPR148.
21788986 2012 Structural basis for the recognition of Asef by adenomatous polyposis coli.
19893577 2009 The adenomatous polyposis coli-associated exchange factors Asef and Asef2 are required for adenoma formation in Apc(Min/+)mice.
19628279 2010 The RAC specific guanine nucleotide exchange factor Asef functions downstream from TEL-AML1 to promote leukaemic transformation.
19525225 2009 Adenomatous polyposis coli and Asef function downstream of hepatocyte growth factor and phosphatidylinositol 3-kinase.
18653540 2008 Phosphorylation and activation of the Rac1 and Cdc42 GEF Asef in A431 cells stimulated by EGF.
17599059 2007 Identification and characterization of Asef2, a guanine-nucleotide exchange factor specific for Rac1 and Cdc42.
More...