Property Summary

NCBI Gene PubMed Count 21
PubMed Score 27.96
PubTator Score 24.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.700 7.2e-04
Astrocytoma, Pilocytic -1.400 1.3e-04
atypical teratoid / rhabdoid tumor -3.200 6.6e-08
breast carcinoma -1.400 1.2e-04
ductal carcinoma in situ -1.200 6.4e-03
ependymoma -1.500 1.4e-07
esophageal adenocarcinoma -2.000 1.8e-02
glioblastoma -1.600 3.8e-05
group 3 medulloblastoma -2.300 6.7e-04
invasive ductal carcinoma -1.700 8.1e-04
lung adenocarcinoma -1.300 2.3e-05
medulloblastoma, large-cell -3.800 1.0e-05
non-inflammatory breast cancer -1.200 4.9e-02
ovarian cancer -1.100 7.4e-04
primitive neuroectodermal tumor -1.400 4.3e-03
spina bifida -1.179 4.0e-02
subependymal giant cell astrocytoma -1.567 4.5e-02

Gene RIF (9)

AA Sequence

MPWEEPAGEKPSCSHSQKAFHMEPAQKPCFTTDMVTWALLCISAETVRGEAPSQPRGIPHRSPVSVDDLW      1 - 70
LEKTQRKKLQKQAHVERRLHIGAVHKDGVKCWRKTIITSPESLNLPRRSHPLSQSAPTGLNHMGWPEHTP     71 - 140
GTAMPDGALDTAVCADEVGSEEDLYDDLHSSSHHYSHPGGGGEQLAINELISDGSVVCAEALWDHVTMDD    141 - 210
QELGFKAGDVIEVMDATNREWWWGRVADGEGWFPASFVRLRVNQDEPADDDAPLAGNSGAEDGGAEAQSS    211 - 280
KDQMRTNVINEILSTERDYIKHLRDICEGYVRQCRKRADMFSEEQLRTIFGNIEDIYRCQKAFVKALEQR    281 - 350
FNRERPHLSELGACFLEHQADFQIYSEYCNNHPNACVELSRLTKLSKYVYFFEACRLLQKMIDISLDGFL    351 - 420
LTPVQKICKYPLQLAELLKYTHPQHRDFKDVEAALHAMKNVAQLINERKRRLENIDKIAQWQSSIEDWEG    421 - 490
EDLLVRSSELIYSGELTRVTQPQAKSQQRMFFLFDHQLIYCKKDLLRRDVLYYKGRLDMDGLEVVDLEDG    491 - 560
KDRDLHVSIKNAFRLHRGATGDSHLLCTRKPEQKQRWLKAFAREREQVQLDQETGFSITELQRKQAMLNA    561 - 630
SKQQVTGKPKAVGRPCYLTRQKHPALPSNRPQQQVLVLAEPRRKPSTFWHSISRLAPFRK              631 - 690
//

Text Mined References (25)

PMID Year Title