Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.82
PubTator Score 4.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Zellweger Syndrome 38 4.262 2.1

Expression

Synonym

Accession Q9NR77
Symbols PMP22

Gene

AA Sequence

MAPAASRLRAEAGLGALPRRALAQYLLFLRLYPVLTKAATSGILSALGNFLAQMIEKKRKKENSRSLDVG      1 - 70
GPLRYAVYGFFFTGPLSHFFYFFMEHWIPPEVPLAGLRRLLLDRLVFAPAFLMLFFLIMNFLEGKDASAF     71 - 140
AAKMRGGFWPALRMNWRVWTPLQFININYVPLKFRVLFANLAALFWYAYLASLGK                   141 - 195
//

Text Mined References (11)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
21102411 2010 Structural basis for docking of peroxisomal membrane protein carrier Pex19p onto its receptor Pex3p.
19946888 2010 Defining the membrane proteome of NK cells.
18174172 2008 Characterization of the interaction between recombinant human peroxin Pex3p and Pex19p: identification of TRP-104 IN Pex3p as a critical residue for the interaction.
16683188 2006 The zinc containing pro-apoptotic protein siva interacts with the peroxisomal membrane protein pmp22.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14709540 2004 PEX19 is a predominantly cytosolic chaperone and import receptor for class 1 peroxisomal membrane proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11590176 2002 Two different targeting signals direct human peroxisomal membrane protein 22 to peroxisomes.
10704444 2000 PEX19 binds multiple peroxisomal membrane proteins, is predominantly cytoplasmic, and is required for peroxisome membrane synthesis.
More...