Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.82
PubTator Score 4.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Zellweger syndrome 37 4.3 2.1

Expression

Synonym

Accession Q9NR77
Symbols PMP22

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

AA Sequence

MAPAASRLRAEAGLGALPRRALAQYLLFLRLYPVLTKAATSGILSALGNFLAQMIEKKRKKENSRSLDVG      1 - 70
GPLRYAVYGFFFTGPLSHFFYFFMEHWIPPEVPLAGLRRLLLDRLVFAPAFLMLFFLIMNFLEGKDASAF     71 - 140
AAKMRGGFWPALRMNWRVWTPLQFININYVPLKFRVLFANLAALFWYAYLASLGK                   141 - 195
//

Text Mined References (11)

PMID Year Title