Property Summary

NCBI Gene PubMed Count 26
Grant Count 17
R01 Count 8
Funding $3,028,600.24
PubMed Score 64.50
PubTator Score 20.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Gene RIF (13)

PMID Text
26190575 The structural basis for ceramide recognition and hydrolysis by human neutral ceramidase has been uncovered.
24397980 These results demonstrate for the first time that adiponectin inhibits TNFalpha-induced inflammatory response via Cav1-mediated ceramidase recruitment and activation in an AdipoR1-dependent fashion.
21531200 cloned a 3000 bp region upstream of the translational start site of the nCDase gene
21530485 c-Jun/AP-1 signaling may, in part, regulate serum-induced nCDase gene transcription
20877624 Observational study of gene-disease association. (HuGE Navigator)
20520628 Both acidic ceramidase (aCDase) and neutral ceramidase (nCDase) activities declined after low- and high-UVB, but returned to normal only in low-UVB cells
17982236 serine palmitoyltransferase and ceramidase are two major ceramide metabolizing enzymes that may have roles in psoriatic epidermis
17475390 the purification and characterization of neutral ceramidase from human ileostomy content, using octanoyl-[(14)C]sphingosine as substrate
16940153 Important for the generation of sphgosine 1 phosphqte (S1P) and S1P-mediated cell proliferation and survival.
16385451 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAKRTFSNLETFLIFLLVMMSAITVALLSLLFITSGTIENHKDLGGHFFSTTQSPPATQGSTAAQRSTAT      1 - 70
QHSTATQSSTATQTSPVPLTPESPLFQNFSGYHIGVGRADCTGQVADINLMGYGKSGQNAQGILTRLYSR     71 - 140
AFIMAEPDGSNRTVFVSIDIGMVSQRLRLEVLNRLQSKYGSLYRRDNVILSGTHTHSGPAGYFQYTVFVI    141 - 210
ASEGFSNQTFQHMVTGILKSIDIAHTNMKPGKIFINKGNVDGVQINRSPYSYLQNPQSERARYSSNTDKE    211 - 280
MIVLKMVDLNGDDLGLISWFAIHPVSMNNSNHLVNSDNVGYASYLLEQEKNKGYLPGQGPFVAAFASSNL    281 - 350
GDVSPNILGPRCINTGESCDNANSTCPIGGPSMCIAKGPGQDMFDSTQIIGRAMYQRAKELYASASQEVT    351 - 420
GPLASAHQWVDMTDVTVWLNSTHASKTCKPALGYSFAAGTIDGVGGLNFTQGKTEGDPFWDTIRDQILGK    421 - 490
PSEEIKECHKPKPILLHTGELSKPHPWHPDIVDVQIITLGSLAITAIPGEFTTMSGRRLREAVQAEFASH    491 - 560
GMQNMTVVISGLCNVYTHYITTYEEYQAQRYEAASTIYGPHTLSAYIQLFRNLAKAIATDTVANLSRGPE    561 - 630
PPFFKQLIVPLIPSIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYE    631 - 700
ATSTSWQIVCNDASWETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEG    701 - 770
TSPAFEVVTI                                                                771 - 780
//

Text Mined References (26)

PMID Year Title
26190575 2015 Structural Basis for Ceramide Recognition and Hydrolysis by Human Neutral Ceramidase.
24397980 2014 Adiponectin inhibits tumor necrosis factor-?-induced vascular inflammatory response via caveolin-mediated ceramidase recruitment and activation.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
21531200 2011 Transcriptional regulation of the human neutral ceramidase gene.
21530485 2011 AP-1 binding transcriptionally regulates human neutral ceramidase.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20520628 2010 Hydrolytic pathway protects against ceramide-induced apoptosis in keratinocytes exposed to UVB.
17982236 2007 A study on altered expression of serine palmitoyltransferase and ceramidase in psoriatic skin lesion.
17475390 2007 Purification and characterization of human intestinal neutral ceramidase.
More...