Property Summary

NCBI Gene PubMed Count 39
Grant Count 16
R01 Count 13
Funding $1,317,782.7
PubMed Score 69.47
PubTator Score 44.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

 GWAS Trait (1)

Gene RIF (22)

PMID Text
25839051 There was increased expression of mRNA CYP26B1 in oral cancer tissue compared to adjacent noncancerous tissues.
25168891 SNPs in three genes CYP26B1 rs2241057, CISD1 rs2251039, rs2590370, and TBX1 rs4819522 were involved in six potential pathways to influence serum prostate-specific antigen levels.
25114974 Our results suggested that the CYP26B1 splice variant is associated with the occurrence of BQ-related oral cancer.
24726878 inhibits fibroblasts-induced activation of mast cells and dermatitis
23977348 homozygous carriers of the major (T) allele, relative to homozygous carriers of the minor (C) allele, of the CYP26B1 polymorphism rs2241057 may have an increased risk for the development of Crohn's disease.
23837398 We report a 2p13.2 microdeletion in 2 subjects encompasing 2 genes, EXOC6B and CYP26B12 with clinical effects on cognitive function, and craniofacial and skeletal development.
23320086 Single nucleotide polymorphisms in CYP26B1, NANOS1 and STRA8 genes support involvement of meiotic program initiation genes in modifying the risk of azoospermia and oligozoospermia in a Han-Chinese population
22666329 Vascular cells express the spliced variant of CYP26B1 lacking exon 2 and it is also increased in atherosclerotic lesions
22415012 CYP26B1 capacity is genetically regulated and suggest that local CYP26B1 activity may influence atherosclerosis.
22020119 The mRNA expression of CYP26A1 and CYP26B1 correlated between human tissues except for human cerebellum in which CYP26B1 was the predominant CYP26 and liver in which CYP26A1 dominated.
More...

AA Sequence

MLFEGLDLVSALATLAACLVSVTLLLAVSQQLWQLRWAATRDKSCKLPIPKGSMGFPLIGETGHWLLQGS      1 - 70
GFQSSRREKYGNVFKTHLLGRPLIRVTGAENVRKILMGEHHLVSTEWPRSTRMLLGPNTVSNSIGDIHRN     71 - 140
KRKVFSKIFSHEALESYLPKIQLVIQDTLRAWSSHPEAINVYQEAQKLTFRMAIRVLLGFSIPEEDLGHL    141 - 210
FEVYQQFVDNVFSLPVDLPFSGYRRGIQARQILQKGLEKAIREKLQCTQGKDYLDALDLLIESSKEHGKE    211 - 280
MTMQELKDGTLELIFAAYATTASASTSLIMQLLKHPTVLEKLRDELRAHGILHSGGCPCEGTLRLDTLSG    281 - 350
LRYLDCVIKEVMRLFTPISGGYRTVLQTFELDGFQIPKGWSVMYSIRDTHDTAPVFKDVNVFDPDRFSQA    351 - 420
RSEDKDGRFHYLPFGGGVRTCLGKHLAKLFLKVLAVELASTSRFELATRTFPRITLVPVLHPVDGLSVKF    421 - 490
FGLDSNQNEILPETEAMLSATV                                                    491 - 512
//

Text Mined References (40)

PMID Year Title
26937021 2016 Identification of Tazarotenic Acid as the First Xenobiotic Substrate of Human Retinoic Acid Hydroxylase CYP26A1 and CYP26B1.
25839051 2015 Association study between novel CYP26 polymorphisms and the risk of betel quid-related malignant oral disorders.
25168891 2014 Pathway analysis of genome-wide association study on serum prostate-specific antigen levels.
25114974 2014 Expression of a splice variant of CYP26B1 in betel quid-related oral cancer.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24726878 2014 The enzyme Cyp26b1 mediates inhibition of mast cell activation by fibroblasts to maintain skin-barrier homeostasis.
23977348 2013 Polymorphism in the retinoic acid metabolizing enzyme CYP26B1 and the development of Crohn's Disease.
23837398 2013 Phenotypic and functional consequences of haploinsufficiency of genes from exocyst and retinoic acid pathway due to a recurrent microdeletion of 2p13.2.
23587162 2013 Peretinoin, an acyclic retinoid, improves the hepatic gene signature of chronic hepatitis C following curative therapy of hepatocellular carcinoma.
23554885 2013 5-Methoxyleoligin, a lignan from Edelweiss, stimulates CYP26B1-dependent angiogenesis in vitro and induces arteriogenesis in infarcted rat hearts in vivo.
More...