Property Summary

NCBI Gene PubMed Count 39
PubMed Score 69.47
PubTator Score 44.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
astrocytic glioma -2.800 6.6e-03
ependymoma -2.500 1.8e-02
oligodendroglioma -2.100 3.3e-02
psoriasis -1.500 5.7e-07
glioblastoma -3.100 2.2e-05
atypical teratoid / rhabdoid tumor -2.900 9.5e-08
group 4 medulloblastoma -1.500 2.6e-02
medulloblastoma, large-cell -2.200 2.3e-03
autosomal dominant Emery-Dreifuss muscul... 1.808 3.4e-03
juvenile dermatomyositis 1.211 8.3e-05
acute quadriplegic myopathy 1.887 6.1e-08
primary pancreatic ductal adenocarcinoma -1.007 4.7e-03
lung cancer -1.800 4.3e-03
active Crohn's disease -2.329 3.0e-02
breast carcinoma -1.100 2.0e-02
fibroadenoma -2.000 2.2e-02
cystic fibrosis 1.600 3.5e-04
pediatric high grade glioma -2.300 2.8e-04
pilocytic astrocytoma -1.100 1.9e-02
aldosterone-producing adenoma -1.638 2.0e-02
subependymal giant cell astrocytoma -3.529 7.0e-03
severe Alzheimer's disease -1.142 5.0e-02
Pick disease -1.200 2.9e-02
ductal carcinoma in situ -2.100 3.8e-04
invasive ductal carcinoma -2.100 4.0e-03
ulcerative colitis 1.600 2.1e-02
pituitary cancer -2.400 1.0e-05
axial spondyloarthropathy 1.200 3.1e-02

 GWAS Trait (1)

Protein-protein Interaction (7)

Gene RIF (22)

PMID Text
25839051 There was increased expression of mRNA CYP26B1 in oral cancer tissue compared to adjacent noncancerous tissues.
25168891 SNPs in three genes CYP26B1 rs2241057, CISD1 rs2251039, rs2590370, and TBX1 rs4819522 were involved in six potential pathways to influence serum prostate-specific antigen levels.
25114974 Our results suggested that the CYP26B1 splice variant is associated with the occurrence of BQ-related oral cancer.
24726878 inhibits fibroblasts-induced activation of mast cells and dermatitis
23977348 homozygous carriers of the major (T) allele, relative to homozygous carriers of the minor (C) allele, of the CYP26B1 polymorphism rs2241057 may have an increased risk for the development of Crohn's disease.
23837398 We report a 2p13.2 microdeletion in 2 subjects encompasing 2 genes, EXOC6B and CYP26B12 with clinical effects on cognitive function, and craniofacial and skeletal development.
23320086 Single nucleotide polymorphisms in CYP26B1, NANOS1 and STRA8 genes support involvement of meiotic program initiation genes in modifying the risk of azoospermia and oligozoospermia in a Han-Chinese population
22666329 Vascular cells express the spliced variant of CYP26B1 lacking exon 2 and it is also increased in atherosclerotic lesions
22415012 CYP26B1 capacity is genetically regulated and suggest that local CYP26B1 activity may influence atherosclerosis.
22020119 The mRNA expression of CYP26A1 and CYP26B1 correlated between human tissues except for human cerebellum in which CYP26B1 was the predominant CYP26 and liver in which CYP26A1 dominated.
22019272 Human null and hypomorphic mutations were identified in the gene encoding the retinoic acid degrading enzyme CYP26B1 that lead to skeletal and craniofacial anomalies, including fusions of long bones, calvarial bone hypoplasia, and craniosynostosis
21945024 Detection of the methylation prevalence of KCNA4 and CYP26B1 together in serum demonstrated the good sensitivity and specificityin gastric cancer
21641851 Increased expression of the CYP26B1 gene was observed in tumor tissue compared with adjacent normal tissue and it plays a novel role in the betel dependent pathogenesis of oral squamous cell carcinoma.
21482329 The presence of CYP26B1 in normal lung development (A549 cell line), & the capacity to convert retinol to retinoic acid, indicates that fetal human lung has the ability to regulate the supply of vitamin A from the pseudoglandular stage.
20606468 role of CYP26 in the regulation of all trans retinoic acid levels in human aortic smooth muscle cells
20375987 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19884280 The predominant expression of CYP26A1 in the liver is in agreement with previous reports of tissue distribution of CYP26 mRNA in adult humans.
19703508 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16933217 Observational study of gene-disease association. (HuGE Navigator)
16574820 Studies in mice found that regulation of retinoid levels, affected by the retinoid-degrading enzyme CYP26B1, during fetal gonad development determined whether germ cells would become oocytes or spermatogonia.
12101034 CYP26B1 mRNA levels were approximately twice the level in adult cerebellum compared to adult whole brain samples. CYP26B1 levels were 10x higher in earlier gestational times than in later gestational times.
11744378 Mouse studies identified different expression patterns of the retinoic acid-metabolizing enzymes CYP26A1 and CYP26B1 during development.

AA Sequence

MLFEGLDLVSALATLAACLVSVTLLLAVSQQLWQLRWAATRDKSCKLPIPKGSMGFPLIGETGHWLLQGS      1 - 70
GFQSSRREKYGNVFKTHLLGRPLIRVTGAENVRKILMGEHHLVSTEWPRSTRMLLGPNTVSNSIGDIHRN     71 - 140
KRKVFSKIFSHEALESYLPKIQLVIQDTLRAWSSHPEAINVYQEAQKLTFRMAIRVLLGFSIPEEDLGHL    141 - 210
FEVYQQFVDNVFSLPVDLPFSGYRRGIQARQILQKGLEKAIREKLQCTQGKDYLDALDLLIESSKEHGKE    211 - 280
MTMQELKDGTLELIFAAYATTASASTSLIMQLLKHPTVLEKLRDELRAHGILHSGGCPCEGTLRLDTLSG    281 - 350
LRYLDCVIKEVMRLFTPISGGYRTVLQTFELDGFQIPKGWSVMYSIRDTHDTAPVFKDVNVFDPDRFSQA    351 - 420
RSEDKDGRFHYLPFGGGVRTCLGKHLAKLFLKVLAVELASTSRFELATRTFPRITLVPVLHPVDGLSVKF    421 - 490
FGLDSNQNEILPETEAMLSATV                                                    491 - 512
//

Text Mined References (40)

PMID Year Title
26937021 2016 Identification of Tazarotenic Acid as the First Xenobiotic Substrate of Human Retinoic Acid Hydroxylase CYP26A1 and CYP26B1.
25839051 2015 Association study between novel CYP26 polymorphisms and the risk of betel quid-related malignant oral disorders.
25168891 2014 Pathway analysis of genome-wide association study on serum prostate-specific antigen levels.
25114974 2014 Expression of a splice variant of CYP26B1 in betel quid-related oral cancer.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24726878 2014 The enzyme Cyp26b1 mediates inhibition of mast cell activation by fibroblasts to maintain skin-barrier homeostasis.
23977348 2013 Polymorphism in the retinoic acid metabolizing enzyme CYP26B1 and the development of Crohn's Disease.
23837398 2013 Phenotypic and functional consequences of haploinsufficiency of genes from exocyst and retinoic acid pathway due to a recurrent microdeletion of 2p13.2.
23587162 2013 Peretinoin, an acyclic retinoid, improves the hepatic gene signature of chronic hepatitis C following curative therapy of hepatocellular carcinoma.
23554885 2013 5-Methoxyleoligin, a lignan from Edelweiss, stimulates CYP26B1-dependent angiogenesis in vitro and induces arteriogenesis in infarcted rat hearts in vivo.
23409080 2013 Knock-down of PRAME increases retinoic acid signaling and cytotoxic drug sensitivity of Hodgkin lymphoma cells.
23320086 2013 Genetic variants in meiotic program initiation pathway genes are associated with spermatogenic impairment in a Han Chinese population.
23303528 2013 Dysregulation of the mitosis-meiosis switch in testicular carcinoma in situ.
23298258 2013 All-trans retinoic acid protects hepatocellular carcinoma cells against serum-starvation-induced cell death by upregulating collagen 8A2.
22985482 2012 Homology models of human all-trans retinoic acid metabolizing enzymes CYP26B1 and CYP26B1 spliced variant.
22965740 2012 Evaluation of genes involved in limb development, angiogenesis, and coagulation as risk factors for congenital limb deficiencies.
22899867 2012 Analysis of meiosis regulators in human gonads: a sexually dimorphic spatio-temporal expression pattern suggests involvement of DMRT1 in meiotic entry.
22666329 2012 Cloning and functional studies of a splice variant of CYP26B1 expressed in vascular cells.
22415012 2012 A CYP26B1 polymorphism enhances retinoic acid catabolism and may aggravate atherosclerosis.
22020119 2012 Comparison of the function and expression of CYP26A1 and CYP26B1, the two retinoic acid hydroxylases.
22019272 2011 Craniosynostosis and multiple skeletal anomalies in humans and zebrafish result from a defect in the localized degradation of retinoic acid.
21945024 2011 Hypermethylated DNA as potential biomarkers for gastric cancer diagnosis.
21641851 2011 CYP26B1 is a novel candidate gene for betel quid-related oral squamous cell carcinoma.
21482329 2011 [A study of the metabolic pathways of vitamin A in the fetal human lung].
20606468 2011 CYP26B1 plays a major role in the regulation of all-trans-retinoic acid metabolism and signaling in human aortic smooth muscle cells.
20375987 2010 A human ALDH1A2 gene variant is associated with increased newborn kidney size and serum retinoic acid.
19884280 2010 A comparison of the roles of peroxisome proliferator-activated receptor and retinoic acid receptor on CYP26 regulation.
19703508 2009 Positive association between ALDH1A2 and schizophrenia in the Chinese population.
16933217 2006 Evidence for a functional genetic polymorphism of the human retinoic acid-metabolizing enzyme CYP26A1, an enzyme that may be involved in spina bifida.
16574820 2006 Retinoid signaling determines germ cell fate in mice.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15128046 2004 Comparison of cytochrome P450 (CYP) genes from the mouse and human genomes, including nomenclature recommendations for genes, pseudogenes and alternative-splice variants.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14532297 2004 A novel human cytochrome P450, CYP26C1, involved in metabolism of 9-cis and all-trans isomers of retinoic acid.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12101034 2002 Developmental expression of cytochrome CYP26B1 (P450RAI-2) in human cephalic tissues.
11744378 2002 Differential expression of the retinoic acid-metabolizing enzymes CYP26A1 and CYP26B1 during murine organogenesis.
10823918 2000 Identification of the human cytochrome P450, P450RAI-2, which is predominantly expressed in the adult cerebellum and is responsible for all-trans-retinoic acid metabolism.
10545224 1999 A second CYP26 P450 in humans and zebrafish: CYP26B1.