Property Summary

NCBI Gene PubMed Count 103
Grant Count 74
R01 Count 47
Funding $6,919,380.89
PubMed Score 240.04
PubTator Score 250.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.545 0.000

Synonym

Accession Q9NR61 Q3KP23 Q9NQT9
Symbols AOS6
hdelta2

Gene

Gene RIF (88)

PMID Text
27487663 Expression of D114 in the vessels of dermal microvasculature was shown to increase from 20 weeks of gestation to 20 years.
26870802 Cyclic AMP Response Element Binding Protein Mediates Pathological Retinal Neovascularization via Modulating DLL4-NOTCH1 Signaling
26808710 Data indicate the role for altered forkhead box C2 (FoxC2)-Delta-like ligand 4 (Dll4)signaling in structural alterations of saphenous veins in patients with varicose veins.
26739060 Antagonism of the DLL4-Notch signaling pathway might provide a potential therapeutic approach for breast cancer treatment by preventing angiogenesis.
26712946 DLL4 is a unique functional molecule of human circulating dendritic cells critical for directing Th1 and Th17 differentiation
26546995 DLL4 and JAG1 may have opposing effects on tumor angiogenesis in glioblastoma.
26471266 DLL4/Notch1 and BMP9 interdependent signaling induces endothelial cell quiescence via P27KIP1/thrombospondin pathway.
26404485 Macrophage Dll4 promotes lesion development in vein grafts via macrophage activation and crosstalk between macrophages and smooth muscle cells.
26299364 Heterozygous Loss-of-Function Mutations in DLL4 Cause Adams-Oliver Syndrome.
26241546 Overexpression of DLL4 is associated with thyroid tumor invasion and metastasis.
More...

AA Sequence

MAAASRSASGWALLLLVALWQQRAAGSGVFQLQLQEFINERGVLASGRPCEPGCRTFFRVCLKHFQAVVS      1 - 70
PGPCTFGTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIEAWHAPGDDLRPEALPPDALI     71 - 140
SKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHFGHYVCQPDGNLSCLP    141 - 210
GWTGEYCQQPICLSGCHEQNGYCSKPAECLCRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEGWGGLF    211 - 280
CDQDLNYCTHHSPCKNGATCSNSGQRSYTCTCRPGYTGVDCELELSECDSNPCRNGGSCKDQEDGYHCLC    281 - 350
PPGYYGLHCEHSTLSCADSPCFNGGSCRERNQGANYACECPPNFTGSNCEKKVDRCTSNPCANGGQCLNR    351 - 420
GPSRMCRCRPGFTGTYCELHVSDCARNPCAHGGTCHDLENGLMCTCPAGFSGRRCEVRTSIDACASSPCF    421 - 490
NRATCYTDLSTDTFVCNCPYGFVGSRCEFPVGLPPSFPWVAVSLGVGLAVLLVLLGMVAVAVRQLRLRRP    491 - 560
DDGSREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGLDKSNCGKQQNHTLDYNLAPGPLGRGTMPGK    561 - 630
FPHSDKSLGEKAPLRLHSEKPECRISAICSPRDSMYQSVCLISEERNECVIATEV                   631 - 685
//

Text Mined References (102)

PMID Year Title
27487663 2016 [CHANGES OF THE CONTENT OF DLL4 AND Jag-1 ANGIOGENESIS REGULATORS IN HUMAN DERMIS IN ONTOGENESIS].
26870802 2015 Cyclic AMP Response Element Binding Protein Mediates Pathological Retinal Neovascularization via Modulating DLL4-NOTCH1 Signaling.
26808710 2016 Arterialization and anomalous vein wall remodeling in varicose veins is associated with upregulated FoxC2-Dll4 pathway.
26739060 2016 MMGZ01, an anti-DLL4 monoclonal antibody, promotes nonfunctional vessels and inhibits breast tumor growth.
26712946 2016 The Notch Ligand DLL4 Defines a Capability of Human Dendritic Cells in Regulating Th1 and Th17 Differentiation.
26546995 2016 The Vascular Notch Ligands Delta-Like Ligand 4 (DLL4) and Jagged1 (JAG1) Have Opposing Correlations with Microvascularization but a Uniform Prognostic Effect in Primary Glioblastoma: A Preliminary Study.
26471266 2015 DLL4/Notch1 and BMP9 Interdependent Signaling Induces Human Endothelial Cell Quiescence via P27KIP1 and Thrombospondin-1.
26404485 2015 Macrophage Notch Ligand Delta-Like 4 Promotes Vein Graft Lesion Development: Implications for the Treatment of Vein Graft Failure.
26299364 2015 Heterozygous Loss-of-Function Mutations in DLL4 Cause Adams-Oliver Syndrome.
26241546 2015 Prognostic significance of DLL4 expression in papillary thyroid cancer.
More...