Property Summary

NCBI Gene PubMed Count 60
PubMed Score 239.02
PubTator Score 244.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Myotonia 10 0.0 0.0
Disease Target Count
Schizophrenia 1160
Disease Target Count P-value
lung carcinoma 2843 1.2e-35
non-small cell lung cancer 2890 2.9e-13
breast carcinoma 1638 6.3e-13
ovarian cancer 8520 6.9e-10
Breast cancer 3578 7.0e-08
medulloblastoma, large-cell 6241 2.1e-05
group 4 medulloblastoma 1855 3.1e-05
juvenile dermatomyositis 1187 6.9e-05
atypical teratoid / rhabdoid tumor 5112 1.0e-04
osteosarcoma 7950 1.5e-04
psoriasis 6694 2.3e-04
Pick disease 1894 4.9e-04
glioblastoma 5792 5.7e-04
acute quadriplegic myopathy 1158 5.9e-04
colon cancer 1478 1.0e-03
ulcerative colitis 1819 1.2e-03
pancreatic cancer 2398 1.2e-03
primary Sjogren syndrome 735 1.3e-03
Rheumatoid arthritis 1191 2.0e-03
interstitial cystitis 2312 2.8e-03
dermatomyositis 966 2.9e-03
lung cancer 4740 3.8e-03
adult high grade glioma 3801 3.8e-03
cystic fibrosis 1696 4.5e-03
astrocytic glioma 2597 4.9e-03
Amyotrophic lateral sclerosis 451 5.3e-03
progressive supranuclear palsy 676 5.6e-03
pancreatic ductal adenocarcinoma liver metastasis 1962 5.9e-03
Waldenstrons macroglobulinemia 765 7.1e-03
oligodendroglioma 2850 9.9e-03
Gaucher disease type 1 180 1.2e-02
limb girdle muscular dystrophy 2B 40 1.3e-02
ependymoma 4679 1.4e-02
hereditary spastic paraplegia 318 1.5e-02
lung adenocarcinoma 2716 1.5e-02
Astrocytoma, Pilocytic 3081 1.6e-02
cystic fibrosis and chronic rhinosinusitis 214 2.1e-02
aldosterone-producing adenoma 665 2.8e-02
intraductal papillary-mucinous adenoma (IPMA) 2955 3.1e-02
intraductal papillary-mucinous carcinoma (IPMC) 2989 3.3e-02
invasive ductal carcinoma 2951 3.8e-02
subependymal giant cell astrocytoma 2287 4.4e-02
pituitary cancer 1972 4.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (43)

Disease log2 FC p
acute quadriplegic myopathy 2.242 5.9e-04
adult high grade glioma 1.400 3.8e-03
aldosterone-producing adenoma -1.837 2.8e-02
Amyotrophic lateral sclerosis 1.073 5.3e-03
astrocytic glioma 1.600 4.9e-03
Astrocytoma, Pilocytic 1.100 1.6e-02
atypical teratoid / rhabdoid tumor -1.300 1.0e-04
Breast cancer -1.300 7.0e-08
breast carcinoma -1.200 6.3e-13
colon cancer -2.100 1.0e-03
cystic fibrosis -1.195 4.5e-03
cystic fibrosis and chronic rhinosinusit... -1.016 2.1e-02
dermatomyositis -1.600 2.9e-03
ependymoma 1.300 1.4e-02
Gaucher disease type 1 -1.300 1.2e-02
glioblastoma 1.300 5.7e-04
group 4 medulloblastoma -1.600 3.1e-05
hereditary spastic paraplegia -1.716 1.5e-02
interstitial cystitis 1.600 2.8e-03
intraductal papillary-mucinous adenoma (... 1.300 3.1e-02
intraductal papillary-mucinous carcinoma... 1.300 3.3e-02
invasive ductal carcinoma -1.100 3.8e-02
juvenile dermatomyositis 1.262 6.9e-05
limb girdle muscular dystrophy 2B -1.087 1.3e-02
lung adenocarcinoma 1.054 1.5e-02
lung cancer -1.100 3.8e-03
lung carcinoma -1.200 1.2e-35
medulloblastoma, large-cell -1.500 2.1e-05
non-small cell lung cancer -1.461 2.9e-13
oligodendroglioma 1.400 9.9e-03
osteosarcoma 2.306 1.5e-04
ovarian cancer -1.800 6.9e-10
pancreatic cancer 1.200 1.2e-03
pancreatic ductal adenocarcinoma liver m... 1.431 5.9e-03
Pick disease 1.700 4.9e-04
pituitary cancer -1.100 4.6e-02
primary Sjogren syndrome 1.400 1.3e-03
progressive supranuclear palsy -1.100 5.6e-03
psoriasis -2.300 2.3e-04
Rheumatoid arthritis 1.200 2.0e-03
subependymal giant cell astrocytoma 2.465 4.4e-02
ulcerative colitis -1.200 1.2e-03
Waldenstrons macroglobulinemia 1.589 7.1e-03

Gene RIF (48)

AA Sequence

MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLH      1 - 70
PPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPV     71 - 140
SPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTM    141 - 210
IDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMTQSAVKSLKRP    211 - 280
LEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPVPMVHGATPATV    281 - 350
SAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM                                    351 - 388
//

Text Mined References (66)

PMID Year Title